DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf18

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_032031.1 Gene:Fgf18 / 14172 MGIID:1277980 Length:207 Species:Mus musculus


Alignment Length:126 Identity:32/126 - (25%)
Similarity:55/126 - (43%) Gaps:11/126 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 RSTVPQSHLAWTSRKIQLYIK--NRILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVAT 298
            |..|.:..|    |..|||.:  .:.:|:|...:....:|.:....:|..:.....:::::...|
Mouse    44 RDDVSRKQL----RLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKET 104

  Fly   299 CLYLCMDACGVPYGSKDFTD-DCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQPRR 358
            ..||||:..|...|..|.|. :|||.|.:...||....|..:|.    :|:.....|:||:
Mouse   105 EFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSG----WYVGFTKKGRPRK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 29/115 (25%)
Fgf18NP_032031.1 FGF 53..175 CDD:395115 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.