DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf17

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_036014351.1 Gene:Fgf17 / 14171 MGIID:1202401 Length:276 Species:Mus musculus


Alignment Length:156 Identity:36/156 - (23%)
Similarity:68/156 - (43%) Gaps:19/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 INSSSSNTPISNLDR--NERSTVPQSHLAWTSRKIQLYIKNRILQILRDG-VVNGTQDENSEFTI 280
            :.:...|.|..|.::  .::..:.........|:.|||.:.....:...| .::.|.::.::|..
Mouse    81 VTAKGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAK 145

  Fly   281 LQRSTVDVG-RIKLQSVATCLYLCMD----ACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHS 340
            |...|...| |::::...:..|:||:    ..|.|.|.   :.||||.|.:...||..:.:..|.
Mouse   146 LIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGK---SKDCVFTEIVLENNYTAFQNARHE 207

  Fly   341 QARRVFYLALNGSGQPRRTQIPASRS 366
            .    :::|....|:||:    ||||
Mouse   208 G----WFMAFTRQGRPRQ----ASRS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 33/126 (26%)
Fgf17XP_036014351.1 FGF 113..235 CDD:395115 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.