DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf14

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_997550.1 Gene:Fgf14 / 14169 MGIID:109189 Length:252 Species:Mus musculus


Alignment Length:200 Identity:59/200 - (29%)
Similarity:100/200 - (50%) Gaps:30/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 NLDRNERSTVPQSHLAWTSRKIQLYIK-NRILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKL 293
            :|.:|:..|.||.....|    :||.: ...||:..||.::||:|:::..|:.....|.:..:.:
Mouse    61 SLKKNKNPTDPQLKGIVT----RLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAI 121

  Fly   294 QSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQ--ARRVFYLALNGSGQ- 355
            |.|.|.||:.|:..|..|.|:.||.:|.|.|::....|..|||..:.|  :.|.::|.||..|| 
Mouse   122 QGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQV 186

  Fly   356 -----PRRTQIPASRSLGK---LSTY----TNAITETVPQERVEQLIAKNFGANRVKHGVRQLCD 408
                 .::|: ||:..|.|   ::.|    .:.:.||||:..|..  :|:..|:.:.:|      
Mouse   187 MKGNRVKKTK-PAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTP--SKSTSASAIMNG------ 242

  Fly   409 TGKPL 413
             |||:
Mouse   243 -GKPV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 43/144 (30%)
Fgf14NP_997550.1 FGF 77..202 CDD:395115 40/129 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8324
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.