DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf13

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001277343.1 Gene:Fgf13 / 14168 MGIID:109178 Length:255 Species:Mus musculus


Alignment Length:240 Identity:67/240 - (27%)
Similarity:98/240 - (40%) Gaps:53/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PISNLDRNERSTVPQSHLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVDVGR 290
            |:..:...|.:...:..|.....|  ||.:... ||:..||.::||:||:|.:|:.....|.:..
Mouse    59 PLKQVHHKENTEPEEPQLKGIVTK--LYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRV 121

  Fly   291 IKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYH--SQARRVFYLALNGS 353
            :.:|.|.|.|||.|::.|..|.|:.||.:|.|.|::....|.||||..:  .|:.|.:||.||..
Mouse   122 VAIQGVQTKLYLAMNSEGYLYTSEHFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKE 186

  Fly   354 GQPRRTQIPASRSLGKLSTYTNAITETVPQERVEQLIAKNFGANRVKHGVRQLCDTGKPLIELID 418
            |:                                  |.|   .|.||..........|||    .
Mouse   187 GE----------------------------------IMK---GNHVKKNKPAAHFLPKPL----K 210

  Fly   419 VARFKAPP-HCSSNTSGSSSSISSSSSSSS------KSSSNSSSS 456
            ||.:|.|. |..:..|.|.|...:.|.|.|      ||.|::.|:
Mouse   211 VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 41/131 (31%)
Fgf13NP_001277343.1 FGF 77..207 CDD:214665 46/168 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8324
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.960

Return to query results.
Submit another query.