DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf12

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_898887.1 Gene:Fgf12 / 14167 MGIID:109183 Length:243 Species:Mus musculus


Alignment Length:276 Identity:71/276 - (25%)
Similarity:104/276 - (37%) Gaps:75/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 QQQPMSPADNNFIGSKSKRLSNP---------RSSLNINS-----SSSNTPISNLDRNERSTVPQ 241
            :|:..:...|:...|.|||.|:|         |..|.:.|     |....|:      .|...||
Mouse    11 RQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPV------RRRPEPQ 69

  Fly   242 SHLAWTSRKIQLYIKNRILQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDA 306
            .....|....|   :...||:..||.::||:||||::|:.....|.:..:.:|.|...||:.|:.
Mouse    70 LKGIVTRLFSQ---QGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNG 131

  Fly   307 CGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQ--ARRVFYLALNGSGQPRRTQIPASRSLGK 369
            .|..|.|..||.:|.|.|::....|..||||.:.|  :.|.::|.||..||..:           
Mouse   132 EGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMK----------- 185

  Fly   370 LSTYTNAITETVPQERVEQLIAKNFGANRVKHGVRQLCDTGKPLIELIDVARFKAPPHCSSNTSG 434
                .|.:.:|.|.                .|.|      .||    |:|..::.|         
Mouse   186 ----GNRVKKTKPS----------------SHFV------PKP----IEVCMYREP--------- 211

  Fly   435 SSSSISSSSSSSSKSS 450
            |...|......|.|||
Mouse   212 SLHEIGEKQGRSRKSS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 39/130 (30%)
Fgf12NP_898887.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 8/27 (30%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 11..38 8/26 (31%)
FGF 74..198 CDD:395115 42/157 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..243 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8324
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.