DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and Fgf10

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_032028.1 Gene:Fgf10 / 14165 MGIID:1099809 Length:209 Species:Mus musculus


Alignment Length:152 Identity:51/152 - (33%)
Similarity:89/152 - (58%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LSNPRSSLNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLY-IKNRILQILRDGVVNGTQD 273
            :|...::.:.:|||.::| |:..|:.||   .:||....|..:|: .....|.|.::|.|:||::
Mouse    44 VSQEATNCSSSSSSFSSP-SSAGRHVRS---YNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKN 104

  Fly   274 ENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTY 338
            |:..:::|:.::|::|.:.::::.:..||.|:..|..||||:|.:||...|.:....||||:|..
Mouse   105 EDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFN 169

  Fly   339 HSQARRVFYLALNGSGQPRRTQ 360
            .....|..|:||||.|.|||.|
Mouse   170 WQHNGRQMYVALNGKGAPRRGQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 40/115 (35%)
Fgf10NP_032028.1 FGF 77..205 CDD:214665 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8324
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm43297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.