DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf11

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_031755504.1 Gene:fgf11 / 101731237 -ID:- Length:235 Species:Xenopus tropicalis


Alignment Length:153 Identity:44/153 - (28%)
Similarity:76/153 - (49%) Gaps:16/153 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 SNLDRNERSTVPQSHLAWTSRKIQLYIKNRI---LQILRDGVVNGTQDENSEFTILQRSTVDVGR 290
            :.|...|:.:.||      .:.|...:.:|:   ||:|.||.:.|:::|.:.:|:.....|.:..
 Frog    55 AQLGTQEKDSEPQ------LKGIITRLLSRVGFYLQLLPDGTIQGSKEEGNPYTLFNVIPVGLRV 113

  Fly   291 IKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQ--ARRVFYLALNGS 353
            :.:||.|...|:.|::.|..|.|..||.:|.|.|::....:.|||||.:.|  :.|.:||.:...
 Frog   114 VAIQSSACGQYVAMNSEGHLYSSPHFTAECQFKESVFENYFVTYSSTLYRQRSSGRCWYLGIYKD 178

  Fly   354 GQPR-----RTQIPASRSLGKLS 371
            |:..     :...||:..|.|||
 Frog   179 GRAMEGNRVKRHRPAAHFLPKLS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 40/135 (30%)
fgf11XP_031755504.1 FGF 72..197 CDD:395115 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48446
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.