DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf20

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001137399.1 Gene:fgf20 / 100233218 XenbaseID:XB-GENE-481880 Length:208 Species:Xenopus tropicalis


Alignment Length:169 Identity:60/169 - (35%)
Similarity:91/169 - (53%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NTPISNLDRNERSTVPQ-SHLAWTSRKIQLYIKNRI-LQILRDGVVNGTQDENSEFTILQRSTVD 287
            |.|::..:|..||.... |||....|:.|||.:... ||||.||.|.||:.::|.|.||:..:|.
 Frog    37 NDPLAQSERLSRSAPSDLSHLQGILRRRQLYCRTGFHLQILPDGNVQGTRQDHSRFGILEFISVA 101

  Fly   288 VGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTY--HSQARRVFYLAL 350
            :|.:.::.|.|.|||.|:..|..:||:..|.:|:|.|......||||||..  |..:.|.:::||
 Frog   102 IGLVSIRGVDTGLYLGMNDKGELFGSEKLTSECIFREQFEENWYNTYSSNLYKHGDSGRRYFVAL 166

  Fly   351 NGSGQPRRTQIPASRSLGKLSTYTNAITETVPQERVEQL 389
            |..|.||    ..:|: .:...:|:.:...|..|:|.:|
 Frog   167 NKDGTPR----DGTRA-KRHQKFTHFLPRPVDPEKVPEL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 48/131 (37%)
fgf20NP_001137399.1 FGF 60..190 CDD:214665 48/134 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8363
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm48446
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.