DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf22

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001137396.1 Gene:fgf22 / 100233215 XenbaseID:XB-GENE-481152 Length:175 Species:Xenopus tropicalis


Alignment Length:125 Identity:48/125 - (38%)
Similarity:62/125 - (49%) Gaps:9/125 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SHLAWTSRKIQLY-IKNRILQILRDGVVNGTQD--ENSEFTILQRSTVDVGRIKLQSVATCLYLC 303
            |||....|..:|| .....|.|...|.|.||:.  .||   |.|..:|.||.:.:.|..:.|||.
 Frog    41 SHLEGDVRWRRLYSAMQYFLTIDASGKVRGTRSYCTNS---IFQVYSVSVGVVAMHSAGSGLYLA 102

  Fly   304 MDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSG---QPRRTQ 360
            ||..|..||.:|:..:|.|.|.:....||:|||...|..||..|:||.|:|   ..|||:
 Frog   103 MDRKGKVYGEEDYGPNCRFRERIEENGYNSYSSERWSHRRRPMYVALRGNGWVKMGRRTR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 45/120 (38%)
fgf22NP_001137396.1 FGF 48..171 CDD:365916 45/118 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8363
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm48446
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.