DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf19

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001136297.1 Gene:fgf19 / 100217329 XenbaseID:XB-GENE-486499 Length:215 Species:Xenopus tropicalis


Alignment Length:160 Identity:44/160 - (27%)
Similarity:69/160 - (43%) Gaps:31/160 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PQSHLAW--TSRKIQLYIKNRI------LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSV 296
            |.....|  :.|...||...|.      |:|..||.|:|.: :.|..::|:...:.||.:.::..
 Frog    33 PHMQNGWGESIRIRHLYTARRFGHDSYYLRIHEDGRVDGDR-QQSMHSLLEIRAIAVGIVAIKGY 96

  Fly   297 ATCLYLCMDACGVPYGSKDFT-DDCVFNENMGLQNYNTYSSTYHSQARRVFYLALNGSGQPRRTQ 360
            .:.|||||.:.|..||...:: |||.|.|.:....||.|.|..|.       :|::.|.:.::.|
 Frog    97 RSSLYLCMGSEGKLYGMHSYSQDDCSFEEELLPDGYNMYKSRKHG-------VAVSLSKEKQKQQ 154

  Fly   361 ------IPASRSLGKLSTYTNAITETVPQE 384
                  :|.|..|..:|        .||.|
 Frog   155 YKGKGYLPLSHFLPVIS--------WVPME 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 39/141 (28%)
fgf19NP_001136297.1 FGF 43..169 CDD:214665 38/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.