DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf9

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_002938621.1 Gene:fgf9 / 100217327 XenbaseID:XB-GENE-484466 Length:208 Species:Xenopus tropicalis


Alignment Length:188 Identity:57/188 - (30%)
Similarity:94/188 - (50%) Gaps:24/188 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 NINSSSSNTPI---SNLDRNERSTVPQ-------SHLAWTSRKIQLYIKNRI-LQILRDGVVNGT 271
            |:.....:||:   .::..:|...:|:       .||....|:.|||.:... |:|..:|.:.||
 Frog    21 NVPVLQVDTPVLLSDHMSHSEAGGLPRGSAVTDLEHLKGILRRRQLYCRTGFHLEIFPNGTIQGT 85

  Fly   272 QDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSS 336
            :.:::.|.||:..::.||.:.::.|.:.|||.|:..|..|||:..|.:|||.|......||||||
 Frog    86 RQDHNRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSS 150

  Fly   337 TY--HSQARRVFYLALNGSGQPR---RTQIPASRSLGKLSTYTNAITETVPQERVEQL 389
            ..  |:...|.:|:|||..|.||   ||:        :...:|:.:...|..|:|.:|
 Frog   151 NLYKHADTGRRYYVALNKDGTPRDGTRTK--------RHQKFTHFLPRPVDPEKVPEL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 46/134 (34%)
fgf9XP_002938621.1 FGF 60..190 CDD:214665 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8363
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000361
OrthoInspector 1 1.000 - - otm48446
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.