DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf1

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001136293.1 Gene:fgf1 / 100217324 XenbaseID:XB-GENE-485966 Length:155 Species:Xenopus tropicalis


Alignment Length:163 Identity:45/163 - (27%)
Similarity:73/163 - (44%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 SSLNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLYIKN--RILQILRDGVVNGTQDENSE 277
            ::.|..:.|.:.||.|..:.:                .||..|  ..|:||.||||:||:|.:..
 Frog     7 TTFNPIAESFSLPIGNYKKPK----------------LLYCNNGGYFLRILPDGVVDGTRDRDDL 55

  Fly   278 FTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYGSKDFTDDCVFNENMGLQNYNTYSSTYHSQA 342
            :..|:.|....|.:.::|..|..||.||:.|..||:....::.:|.|.:...:||||.|..:::.
 Frog    56 YITLKLSAQSQGEVHIKSTETGSYLAMDSSGQLYGTLTPNEESLFLETLEENHYNTYKSKKYAEN 120

  Fly   343 RRVFYLALNG-SGQPRRTQ----------IPAS 364
            .....:..|| |.:..||.          :|||
 Frog   121 NWFVGIKKNGASKKGSRTHYGQKAILFLPLPAS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 40/131 (31%)
fgf1NP_001136293.1 FGF 25..148 CDD:395115 37/138 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.