DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnl and fgf11b

DIOPT Version :9

Sequence 1:NP_732452.1 Gene:bnl / 42356 FlyBaseID:FBgn0014135 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_001920354.2 Gene:fgf11b / 100149844 ZFINID:ZDB-GENE-100316-2 Length:246 Species:Danio rerio


Alignment Length:268 Identity:63/268 - (23%)
Similarity:101/268 - (37%) Gaps:89/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RSSLNINSSSSNTPISNLDRNERSTVPQSHLAWTSRKIQLYI-KNRI------------------ 259
            |....:....:|.||:    |:|...|:|:.:...::|.:.| |.|:                  
Zfish    10 RQKRAVKDDQANRPIA----NKRKPCPKSNKSLCQKQILVLISKVRLCGGRRGRTDKRPEPQLKG 70

  Fly   260 ------------LQILRDGVVNGTQDENSEFTILQRSTVDVGRIKLQSVATCLYLCMDACGVPYG 312
                        ||:|.||.::||:||||.|:......|.:..:.:|...|..||.|::.|..|.
Zfish    71 IVTRLYSQHGYYLQMLPDGTMDGTRDENSCFSQFNLIPVGLRIVAIQGAKTGFYLGMNSEGYLYT 135

  Fly   313 SKDFTDDCVFNENMGLQNYNTYSSTYH--SQARRVFYLALNGSGQPRRTQIPASRSLGKLSTYTN 375
            |:.|..:|.|.|::....|.||||..:  ||:.|.:|:.:|..||..:         |.....|.
Zfish   136 SEHFNPECKFKESVFENYYVTYSSMLYRQSQSGRSWYIGINRDGQVMK---------GNRVKKTK 191

  Fly   376 AITETVPQERVEQLIAKNFGANRVKHGVRQLCDTGKPLIELIDVARFK-----------APPHCS 429
            |....:|                                ::|:||.:|           :||..:
Zfish   192 AAAHFLP--------------------------------KVIEVAMYKEPSLHELVAEQSPPRKT 224

  Fly   430 SNTSGSSS 437
            ..||.|.|
Zfish   225 VKTSDSPS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnlNP_732452.1 FGF 247..376 CDD:214665 43/161 (27%)
fgf11bXP_001920354.2 FGF 72..197 CDD:278592 40/133 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8416
eggNOG 1 0.900 - - E1_KOG3885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.