DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acsx4 and BZO1

DIOPT Version :10

Sequence 1:NP_650832.1 Gene:Acsx4 / 42355 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_176763.1 Gene:BZO1 / 842900 AraportID:AT1G65880 Length:580 Species:Arabidopsis thaliana


Alignment Length:40 Identity:9/40 - (22%)
Similarity:18/40 - (45%) Gaps:6/40 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VYAAVAWLSTLLTFISSEKFSVYMSKPGDTYLKTLSMLLI 125
            |::....||.:::..:.:...|.|....|      ||:|:
plant   121 VHSGTGLLSKIMSHKTLKNIPVIMMSSHD------SMVLV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acsx4NP_650832.1 Firefly_Luc_like 46..519 CDD:341237 9/40 (23%)
BZO1NP_176763.1 PLN03102 1..580 CDD:215576 9/40 (23%)

Return to query results.
Submit another query.