DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11453 and Acsbg3

DIOPT Version :9

Sequence 1:NP_650832.1 Gene:CG11453 / 42355 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_084417.1 Gene:Acsbg3 / 78625 MGIID:1925875 Length:705 Species:Mus musculus


Alignment Length:497 Identity:97/497 - (19%)
Similarity:191/497 - (38%) Gaps:133/497 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RIAQQLKAMGLKQDDVVGIVGTNTTYLMPVVLGCLLNG----TPFHAVSPWQ----DEDTIKHLF 123
            |.|:....:||::...|||:|.|::..:...:|.::.|    ....::||..    .|.:...:|
Mouse   114 RAAKAFLKVGLERFHGVGIMGINSSEWVIASIGAIMAGGISVGILSSISPKACQVIAETSEMDIF 178

  Fly   124 SITRPKLIFCDGKCFQRLSIIARILKSHVYTLKDHRLGMPRVE----------DLLEPTTAE-LY 177
            .:...:.:       |:::.|...|| |:..:..:|..:...:          ||.:..:.| |.
Mouse   179 VVDNDRQL-------QKINQIQGYLK-HLKAIIQYREDIQEAQPNLYSWKGFLDLADGISDEKLD 235

  Fly   178 YVPETLLLGGDHTVAILCTSGTTGLPKAVCISN-------SACLFDFGF---VTGQDVLLSFSTI 232
            .:.:|  |..:...|::...||||..||:.:|:       :|.:...||   ..||::|:|:..:
Mouse   236 KIIDT--LKPNQCCALVYNQGTTGPSKAIMLSHDNITWTTAAIVQSLGFKCPPQGQEILVSYLPL 298

  Fly   233 DWSAGMFNMLFSCCHGSTRII----------------------TDRPYTP--EYMIQLVEKYKVT 273
                         |....:|:                      :..|.||  .::::|:.:.:.|
Mouse   299 -------------CFPGIQILDVWVAISVAGTVYFPSLDSGKWSGLPRTPGTGFLMELLREVQPT 350

  Fly   274 LLTVVP---QQVASLLKTPTLN----KQRL------------ASIRFVSVGGGSCY--------- 310
            ....:|   .::...|||..|:    ::|:            ..:....:....|:         
Mouse   351 TFCGIPWVWDRMLDSLKTKFLDSTAFRRRIDHWAMRMGLHTNKKLMMGEIHQPLCFGLAKRLTFE 415

  Fly   311 ----VANLLKLQEFLITGQ----------------ISYGYALTECGGV--AANMGVAKPSSVGRI 353
                ...|...|:||..|.                |...|.|:||.|:  .:|:...:..|.|:.
Mouse   416 RARKFLGLNHCQQFLNMGMGLPSGTLDFFLSVNIPIMELYGLSECTGLHTVSNLQAYRILSAGKA 480

  Fly   354 VPGVRVKILDEAGRSLGHGETGEILVHNGKVWNGYYANPNESKRMQDYQGWFHTGDMGYFDNENY 418
            :|....|:..|....:|:     :.:....::.||..:...::|..|..||.||.|:|:.|.:.:
Mouse   481 LPKTHTKVEKENKDGIGN-----LCIWGRHIFMGYLRDKQSTERKVDTHGWLHTNDLGFLDFDKF 540

  Fly   419 LHIVERKEDLLRF-HGAQYSPQEIEQ-VIAELPDVIEACVFG 458
            |:::....||::. .|...:|..||: |...:|.|..|.:.|
Mouse   541 LYVMGNNNDLIKLSSGEMVNPYPIEERVRTRIPIVRYAMLVG 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11453NP_650832.1 CaiC 18..530 CDD:223395 97/497 (20%)
Firefly_Luc_like 46..519 CDD:213279 97/497 (20%)
Acsbg3NP_084417.1 FAA1 74..701 CDD:223953 97/497 (20%)
ACSBG_like 95..700 CDD:213299 97/497 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.