DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11453 and ACSF3

DIOPT Version :9

Sequence 1:NP_650832.1 Gene:CG11453 / 42355 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_005256350.1 Gene:ACSF3 / 197322 HGNCID:27288 Length:610 Species:Homo sapiens


Alignment Length:505 Identity:115/505 - (22%)
Similarity:198/505 - (39%) Gaps:108/505 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TNGEAITFAIRIAQQLKAM------GLKQDDVVGIVGTNTTYLMPVVLGCLLNG--TPFHAVSPW 113
            |..|..:.::|::|::..:      .|:::.|..:...:.:|::......:..|  .|.:...| 
Human    67 TYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGGVAVPLYRKHP- 130

  Fly   114 QDEDTIKHLFSITRPKLIFCDGKCFQRLSIIARILKSHVYTLKDHRLGMPRVEDLLEPTTAELYY 178
              ...::::...::..::....:..:.||.:.|            :||:|     |.|.|..:|.
Human   131 --AAQLEYVICDSQSSVVLASQEYLELLSPVVR------------KLGVP-----LLPLTPAIYT 176

  Fly   179 ----------VPETLLLGGDHTVA-ILCTSGTTGLPKAVCISNSACLFDFGFVTG---------Q 223
                      |||.   |..:..| |:.||||||.||.|..::....   ..|||         .
Human   177 GAVEEPAEVPVPEQ---GWRNKGAMIIYTSGTTGRPKGVLSTHQNIR---AVVTGLVHKWAWTKD 235

  Fly   224 DVLLSFSTIDWSAGMFNMLFSCCH---GSTRIITDRPYTPEYMIQLV-EKY------KVTLLTVV 278
            ||:|....:....|:.|.|.  |.   |:|.::     .||:..|.| ||:      ::.:...|
Human   236 DVILHVLPLHHVHGVVNALL--CPLWVGATCVM-----MPEFSPQQVWEKFLSSETPRINVFMAV 293

  Fly   279 PQQVASLLK------TPTLNKQRLAS-----IRFVSVGGGSCYVANLLKLQEFLITGQ-ISYGYA 331
            |.....|::      |....:..|.:     ||.:..|..:..:..|.|.:.  |||. :...|.
Human   294 PTIYTKLMEYYDRHFTQPHAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKN--ITGHTLLERYG 356

  Fly   332 LTECGGVAA---NMGVAKPSSVGRIVPGVRVKIL-----------------DEAGRSLGHG---E 373
            :||.|...:   ...|..|.|||..:|||:|:|:                 ||.|..:..|   :
Human   357 MTEIGMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEEK 421

  Fly   374 TGEILVHNGKVWNGYYANPNESKRMQDYQGWFHTGDMGYFDNENYLHIVERKEDLLRFHGAQYSP 438
            .||:||....|:..|:..|.|:|......|||.|||...|.:..|........|:::..|.:.|.
Human   422 EGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTGGYKVSA 486

  Fly   439 QEIEQVIAELPDVIEACVFGLWNEVDGDPAAAAVVKIPGSRLTEMDIVEY 488
            .|:|..:...|.:.:..|.|:.:...|....|.|....|..|:..::.|:
Human   487 LEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEW 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11453NP_650832.1 CaiC 18..530 CDD:223395 115/505 (23%)
Firefly_Luc_like 46..519 CDD:213279 115/505 (23%)
ACSF3XP_005256350.1 MCS 55..546 CDD:341264 115/505 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.