DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11453 and ACSM2A

DIOPT Version :9

Sequence 1:NP_650832.1 Gene:CG11453 / 42355 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001295101.1 Gene:ACSM2A / 123876 HGNCID:32017 Length:577 Species:Homo sapiens


Alignment Length:513 Identity:131/513 - (25%)
Similarity:207/513 - (40%) Gaps:90/513 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AMGLKQDDVVGIVGTNTTYLMPVVLGCLLNGTPFHAVSPWQDEDTIKHLFSITRPKLIFCDGKCF 138
            |.||::.|.|.:|.........|:|||:..|..|...:.......|.:...:::.|.|....:..
Human   100 ACGLQRGDRVAVVLPRVPEWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVI 164

  Fly   139 QRLSIIARILKSHVYTLKDHRL-------GMPRVEDLL-EPTTAELYYVPETLLLGGDHTVAILC 195
            |.:..:|    |...:|:...|       |....:.|| |.:|.  ::..||   |.....||..
Human   165 QEVDTVA----SECPSLRIKLLVSEKSCDGWLNFKKLLNEASTT--HHCVET---GSQEASAIYF 220

  Fly   196 TSGTTGLPKAVCISNSA----CLFDFGFVTG---QDVLLSFSTIDWSAGMFNMLFSCCH----GS 249
            ||||:||||....|.|:    ...|.|: ||   .|::.:.|...|   :.|:|.|...    |:
Human   221 TSGTSGLPKMAEHSYSSLGLKAKMDAGW-TGLQASDIMWTISDTGW---ILNILCSLMEPWALGA 281

  Fly   250 TRIITDRP-YTPEYMIQLVEKYKVTLLTVVPQQVASLLKTPTLNKQRLASIRFVSVGGGSCYVAN 313
            ...:...| :.|..:::.:..|.:..:...|.....||      :|.|:|.:|.       ::.|
Human   282 CTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLL------QQDLSSYKFP-------HLQN 333

  Fly   314 LLKLQEFLI----------TG-QISYGYALTECG---GVAANMGVAKPSSVGRIVPGVRVKILDE 364
            .:.:.|.|:          || .|...|..||.|   .|:..|.: ||..:|.......|:|:|:
Human   334 CVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKI-KPGYMGTAASCYDVQIIDD 397

  Fly   365 AGRSLGHGETGEILVHNGK-----VWNGYYANPNESKRMQDYQG--WFHTGDMGYFDNENYLHIV 422
            .|..|..|..|:|.:....     :::||..||:  |...:.:|  |. .||.|..|.:.|...:
Human   398 KGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPD--KTAANIRGDFWL-LGDRGIKDEDGYFQFM 459

  Fly   423 ERKEDLLRFHGAQYSPQEIEQVIAELPDVIEACVFGLWNEVDGDPAAAAVVK---IPGSRLTEMD 484
            .|..|::...|.:..|.|:|..:.|.|.|:|..|..     ..||....|||   :..|:....|
Human   460 GRANDIINSSGYRIGPSEVENALMEHPAVVETAVIS-----SPDPVRGEVVKAFVVLASQFLSHD 519

  Fly   485 IVEYVAKRLVVDHKQLHC------GVFFLPELPKTGSGKVLRQQARDQALGKKWADHG 536
             .|.:.|.|....|.:..      .:.|:..||||.:||:.|.:.||    |:|...|
Human   520 -PEQLTKELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQRAKLRD----KEWKMSG 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11453NP_650832.1 CaiC 18..530 CDD:223395 128/505 (25%)
Firefly_Luc_like 46..519 CDD:213279 125/494 (25%)
ACSM2ANP_001295101.1 AFD_class_I 40..568 CDD:388389 129/507 (25%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 469..471 0/1 (0%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 540..542 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.