DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acsx3 and C25G6.3

DIOPT Version :10

Sequence 1:NP_650831.1 Gene:Acsx3 / 42354 FlyBaseID:FBgn0038733 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_508231.2 Gene:C25G6.3 / 182919 WormBaseID:WBGene00016108 Length:578 Species:Caenorhabditis elegans


Alignment Length:53 Identity:16/53 - (30%)
Similarity:24/53 - (45%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SPTVLTYSSYLGLSGFYYSIYWFIFCF-ILVCLLFFMNFSSYFLNFSGALRKV 144
            :|.:|.|..:...|    |:|....|| |.:|.|.|.:     |...|.|::|
 Worm   289 TPVMLDYKIHDENS----SLYNTPPCFGIYMCGLVFED-----LLEQGGLKEV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acsx3NP_650831.1 Firefly_Luc_like 47..522 CDD:341237 16/53 (30%)
C25G6.3NP_508231.2 AMP-binding 99..516 CDD:459834 16/53 (30%)
Adenylate forming domain, Class I superfamily <462..578 CDD:473059
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.