DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11407 and acsbg1

DIOPT Version :9

Sequence 1:NP_650831.1 Gene:CG11407 / 42354 FlyBaseID:FBgn0038733 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:250 Identity:49/250 - (19%)
Similarity:88/250 - (35%) Gaps:82/250 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DRKIWSGD---QLEYYFD---PH--LSIGEIIFNEMRRHPQLIAQISATENTI---LTRAELQAN 65
            :.|:|:.:   .::...|   |.  :::.::....:.::..|.| :|...|.|   :|..:....
 Frog    19 EEKLWTTEANGSVQLRIDALCPQSPITVHQMFLESVDKYGPLDA-LSTKRNGIWEHVTFMDYYKL 82

  Fly    66 AMHIASYMRSLGLLQMDIVGIIARNTTH--ISAVAYACFFNGI-----------AFH------SL 111
            ....|.....|||.:...|||:..|:..  |||:. ..|..||           |.|      .:
 Frog    83 CRQAAKSFLKLGLERFHSVGILGFNSEEWFISAIG-TVFAGGIITGIYTTNSPEACHYVASDCKM 146

  Fly   112 NISY--EQSTIEKLFSI-------------------TRPNIIFCDGDEFEKVRSATAQLDVKIIT 155
            ||..  .|..:||:..|                   .|||:.  ..:||.:.....|        
 Frog   147 NIIVVENQKQLEKILQIWDGLPHLKAVVQYKGNLQEKRPNLY--TWEEFMEFGKDIA-------- 201

  Fly   156 MRNHPSGSIRIDQVLSTPIEKNFQPVRLEQGNDQTLAILCSSGTTGIPKAVTITN 210
                   ...:|.::::            |..:|...::.:|||||.||.|.:::
 Frog   202 -------DAHLDDIINS------------QKANQCCVLIYTSGTTGNPKGVMLSH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11407NP_650831.1 CaiC 26..523 CDD:223395 47/232 (20%)
Firefly_Luc_like 47..522 CDD:213279 44/206 (21%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 42/201 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.