DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11391 and CMR2

DIOPT Version :9

Sequence 1:NP_650830.1 Gene:CG11391 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_014736.1 Gene:CMR2 / 854260 SGDID:S000005619 Length:1648 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:39/191 - (20%)
Similarity:68/191 - (35%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLNG--NPATSYDPVQKVWSGCSRHSLYNEELTVGQIIFRQLQRQPQRIFQISHTDNTRLTRFQM 65
            ||.|  |...|| .|::|:.....|||.|:...|.: .|::.:....:|...|...........|
Yeast  1089 DLKGLVNIIQSY-KVKRVFVDAKLHSLLNDNNVVNK-CFKKYKSLIPKITVFSKVKTKNALTVSM 1151

  Fly    66 LQNAAKIGCYLRDQGFKKETDLVGLMARNSTHVGALAYGCLFNGTPFHAVNPNLE----HNTISS 126
            .:|..|       |.|.         |:..|.:|...  |:......:.|..|:.    |:::.:
Yeast  1152 FKNVLK-------QKFG---------AKPGTRIGMTP--CVVWVNTEYDVTSNIHVTMTHSSLLN 1198

  Fly   127 LYKITRPRI----------LCCDTADYEKIKDIGASLGALIITVNGKLPGVISVADILQNP 177
            ..||.:..:          :|..|:      .:|.....|:....|....:.|:.|:|.:|
Yeast  1199 ASKIVKETLQLRNNSPLFSICSHTS------GLGFMFSCLLGIYTGASTCLFSLTDVLTDP 1253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11391NP_650830.1 CaiC 24..541 CDD:223395 31/168 (18%)
AFD_class_I 51..527 CDD:302604 24/141 (17%)
CMR2NP_014736.1 DMAP_binding 5..121 CDD:368923
AFD_class_I 179..893 CDD:418409
Dip2 1004..1626 CDD:341231 39/191 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.