DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11391 and Acsf3

DIOPT Version :9

Sequence 1:NP_650830.1 Gene:CG11391 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster
Sequence 2:XP_574249.5 Gene:Acsf3 / 498962 RGDID:1586037 Length:583 Species:Rattus norvegicus


Alignment Length:514 Identity:118/514 - (22%)
Similarity:198/514 - (38%) Gaps:92/514 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GCYLRDQGFKKETDLVGLMARNSTHVGALAYGCLFNG---TPFHAVNPNLEHNTISSLYKITRPR 134
            ||.:.|    .:.:.|..:..|........:....:|   .|.:..:|..:   :....:.:|..
  Rat    87 GCKVGD----LQEERVSFLCSNDVSYVIAQWASWMSGGVAVPLYRKHPEAQ---LEYFIQDSRSS 144

  Fly   135 ILCCDTADYEKIKDIGASLGALIITVNGKLPGVISVADILQNPLPDDYEPAQFQRGVDRTMAILC 199
            ::.......|::..:...||..::.:.   |.|...|  .:.|:.   :|.|.:...||...|..
  Rat   145 VVVVGQEYLERLSPLAQRLGVPLLPLT---PAVYHGA--AEKPIE---QPIQEREWRDRGAMIFY 201

  Fly   200 SSGTTGTPKAVTLSNSRKLFE-----MHSYLGS-DDVQYAPSTLDWLTGLI-----------TLV 247
            :|||||.||. .||..|.|..     :||:..: :||......|..:.|::           |.|
  Rat   202 TSGTTGRPKG-ALSTHRNLAAVVTGLVHSWAWTKNDVILHVLPLHHVHGVVNKLLCPLWVGATCV 265

  Fly   248 TAAVFGT----VRLISSE-----MFST-----AHFLDICEQHEVSWTIMANSHVA--MLANCPKT 296
            ....|..    .:.:|||     ||..     :..||..::|      ...|||.  :.|.|   
  Rat   266 MLPEFSAQQVWEKFLSSEAPQINMFMAVPTIYSKLLDYYDRH------FTQSHVQDFVRAVC--- 321

  Fly   297 SAQKLRSLKHLLFAGGHCL-VATLKKMQSFLHGSG-ILRNAYGLTEVGTLVSYNYDTQSKPTSVG 359
             .:::|    |:.:|...| |..|:|.:|   .:| .|...||:||:|..:|........|.|||
  Rat   322 -KERIR----LMVSGSAALPVPLLEKWKS---ATGHTLLERYGMTEIGMALSNPLTEARVPGSVG 378

  Fly   360 RLMANIRVKIVD------------SSGQLQGPK---GL----GEILCHNGQPWSGYVGNPLATAE 405
            ..:..:.|:||.            :.|.::|.|   |.    ||:|......:..|...|..|..
  Rat   379 TPLPGVEVRIVSENPQKGSSYTIHAEGNMRGTKVTPGFEEKEGELLVKGPSVFQEYWDKPEETKS 443

  Fly   406 MRDSAGWYHTGDVGYFDEDHYLHIVERKKDMLKYLGMMYYPHEVEEVIAQMPDVAEVCVFGIFRE 470
            .....||:.|||...|.:|.|........|::|..|......|:|..:...|.:.:|.|.|:...
  Rat   444 AFTPDGWFRTGDTAVFKDDRYWIRGRTSVDIIKTGGYKVSALEIERHLLAHPSITDVAVIGVPDM 508

  Fly   471 TEGDAAAASVVLRSGSKLDPKHVEQYVRKNVSVQFKHLHGGVQFVPQLAKSANGKVNRQ 529
            |.|....|.|.|:.|..|..:.::::.| .|...:. :...:..|..:.::..||||::
  Rat   509 TWGQRVTAVVALQEGHSLSHRDLKEWAR-GVLAPYA-VPSELLLVEAIPRNQMGKVNKK 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11391NP_650830.1 CaiC 24..541 CDD:223395 118/514 (23%)
AFD_class_I 51..527 CDD:302604 116/510 (23%)
Acsf3XP_574249.5 CaiC 49..572 CDD:223395 118/514 (23%)
MCS 55..564 CDD:213307 117/511 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.