DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11391 and Acsm2

DIOPT Version :9

Sequence 1:NP_650830.1 Gene:CG11391 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_653349.1 Gene:Acsm2 / 246263 RGDID:708383 Length:572 Species:Rattus norvegicus


Alignment Length:468 Identity:113/468 - (24%)
Similarity:194/468 - (41%) Gaps:65/468 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GCLFNGTPFHAVNPNLEHNTISSLYKITRPRILCCDTADYEKIKDIGA-----SLGALIITVNGK 163
            ||:.:|..|......::...|  ||::...:.......| |.::::.|     |...:.:.|:.|
  Rat   125 GCMRSGLVFMPGTTQMKSTDI--LYRLQSSKARAIVAGD-EVVQEVDAVAPDCSFLKIKLLVSEK 186

  Fly   164 -LPGVISVADILQ--NPLPDDYEPAQFQRGVDRTMAILCSSGTTGTPKAV-----TLSNSRKLFE 220
             ..|.::...:|:  :|:....|...     ..:.||..:|||:|.||..     :|....|:..
  Rat   187 NREGWLNFKALLKDASPIHQCVETVS-----QESAAIYFTSGTSGPPKMAEHSHCSLGLKAKMDA 246

  Fly   221 MHSYLGSDDVQYAPSTLDWLTGLI-TLVTAAVFGT---VRLISSEMFSTAHFLDICEQHEVSWTI 281
            ..:.||..|..:..|...|:..:: :.:...|.||   |.|:..  |.....|.:...:.::..:
  Rat   247 GWTGLGPSDTMWTISDTGWILNILGSFLEPWVLGTCIFVHLLPK--FDPQTVLKVLSSYPINTLL 309

  Fly   282 MANSHVAMLANCPKTSAQKLRSLK----HLLFAGGHCLVATLKKMQSFLHGSGI-LRNAYGLTEV 341
            .|.....||..      |.|.|.|    |..|:||..|:.  :.::|:...:|: :|..||.||.
  Rat   310 GAPLIYRMLLQ------QDLSSYKFPHLHSCFSGGETLLP--ETLESWKAKTGLEIREIYGQTET 366

  Fly   342 GTLVSYNYDTQSKPTSVGRLMANIRVKIVDSSGQLQGPKGLGEILCHNGQP------WSGYVGNP 400
            |.....:...:.||..:|..:....|:::|..|.:..|...|: :....:|      :||||.||
  Rat   367 GITCRVSRTMKVKPGYLGTAIVPYDVQVIDEQGNVLPPGKEGD-MALRVKPIRPIGMFSGYVDNP 430

  Fly   401 LAT-AEMRDSAGWYHTGDVGYFDEDHYLHIVERKKDMLKYLGMMYYPHEVEEVIAQMPDVAEVCV 464
            ..| |.:|  ..::..||.|..|.:.|.|.:.|..|::...|....|.|||..:.:.|.|.|..|
  Rat   431 KKTQANIR--GDFWLLGDRGIKDTEGYFHFMGRTDDIINSSGYRIGPSEVENALMEHPAVVETAV 493

  Fly   465 FGIFRETEGDAAAASVVLRSG---------SKLDPKHVEQYVRKNVSVQFKHLHGGVQFVPQLAK 520
            .........:...|.|||...         :|:..:||     |:|:..:|:.. .|:||..|.|
  Rat   494 ISSPDPIRREVVKAFVVLAPEFLSHDQDQLTKVLQEHV-----KSVTAPYKYPR-KVEFVLDLPK 552

  Fly   521 SANGKVNRQAVKA 533
            :..||:.|..::|
  Rat   553 TITGKIERAKLRA 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11391NP_650830.1 CaiC 24..541 CDD:223395 113/468 (24%)
AFD_class_I 51..527 CDD:302604 111/460 (24%)
Acsm2NP_653349.1 AFD_class_I 40..568 CDD:302604 113/468 (24%)
Acs 40..565 CDD:223442 112/466 (24%)
Coenzyme A binding. /evidence=ECO:0000250 469..471 0/1 (0%)
Coenzyme A binding. /evidence=ECO:0000250 540..542 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.