DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11391 and ACSF3

DIOPT Version :9

Sequence 1:NP_650830.1 Gene:CG11391 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster
Sequence 2:XP_005256350.1 Gene:ACSF3 / 197322 HGNCID:27288 Length:610 Species:Homo sapiens


Alignment Length:528 Identity:119/528 - (22%)
Similarity:205/528 - (38%) Gaps:117/528 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GQIIFRQLQRQPQRIFQISHTDNTRLTRFQMLQNAAKIGCYLRDQGFKKETDLVGLMARNSTHVG 99
            |:..:|:|..:..|:.|    :..||           .||.   .|..:|..:..|.|.::::|.
Human    64 GRHTYRELYSRSLRLSQ----EICRL-----------CGCV---GGDLREERVSFLCANDASYVV 110

  Fly   100 ALAYGCLFNG--TPFHAVNP--NLEHNTISSLYKITRPRILCCD--------TADY-EKIKDIGA 151
            |.....:..|  .|.:..:|  .||:              :.||        :.:| |.:..:..
Human   111 AQWASWMSGGVAVPLYRKHPAAQLEY--------------VICDSQSSVVLASQEYLELLSPVVR 161

  Fly   152 SLGALIITVNGKLPGVI--SVADILQNPLPDDYEPAQFQRGVDRTMAILCSSGTTGTPKAV--TL 212
            .||..::.:.   |.:.  :|.:..:.|:|:       |...::...|:.:|||||.||.|  |.
Human   162 KLGVPLLPLT---PAIYTGAVEEPAEVPVPE-------QGWRNKGAMIIYTSGTTGRPKGVLSTH 216

  Fly   213 SNSRKLFE--MHSYLGS-DDVQYAPSTLDWLTGLI-----------TLVTAAVFGT----VRLIS 259
            .|.|.:..  :|.:..: |||......|..:.|::           |.|....|..    .:.:|
Human   217 QNIRAVVTGLVHKWAWTKDDVILHVLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLS 281

  Fly   260 SE-------MFSTAHFLDICEQHEVSWTIMANSHVAMLANCPKTSAQKLRSLKHLLFAGGHCL-V 316
            ||       |.....:..:.|.::..:| ..::...:.|.|    .:|:|    |:.:|...| :
Human   282 SETPRINVFMAVPTIYTKLMEYYDRHFT-QPHAQDFLRAVC----EEKIR----LMVSGSAALPL 337

  Fly   317 ATLKKMQSFLHGSGILRNAYGLTEVGTLVSYNYDTQSK-PTSVGRLMANIRVKIVD--------- 371
            ..|:|.:: :.|..:|.. ||:||:|..:|....|..: |.|||..:..::|:||.         
Human   338 PVLEKWKN-ITGHTLLER-YGMTEIGMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACS 400

  Fly   372 ----SSGQLQGPK---GL----GEILCHNGQPWSGYVGNPLATAEMRDSAGWYHTGDVGYFDEDH 425
                :.|..:|.|   |.    ||:|......:..|...|..|.......||:.|||...|.:..
Human   401 YTIHAEGDERGTKVTPGFEEKEGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDGQ 465

  Fly   426 YLHIVERKKDMLKYLGMMYYPHEVEEVIAQMPDVAEVCVFGIFRETEGDAAAASVVLRSGSKLDP 490
            |........|::|..|......|||..:...|.:.:|.|.|:...|.|....|.|.||.|..|..
Human   466 YWIRGRTSVDIIKTGGYKVSALEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSH 530

  Fly   491 KHVEQYVR 498
            :.::::.|
Human   531 RELKEWAR 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11391NP_650830.1 CaiC 24..541 CDD:223395 119/528 (23%)
AFD_class_I 51..527 CDD:302604 115/512 (22%)
ACSF3XP_005256350.1 MCS 55..546 CDD:341264 119/528 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.