DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11391 and SLC27A2

DIOPT Version :9

Sequence 1:NP_650830.1 Gene:CG11391 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_003636.2 Gene:SLC27A2 / 11001 HGNCID:10996 Length:620 Species:Homo sapiens


Alignment Length:552 Identity:118/552 - (21%)
Similarity:220/552 - (39%) Gaps:76/552 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RQLQRQPQRIFQISHTDNTRLTRFQMLQNAAKIGCYLRDQGFKKETDLVGLMARNSTHVGALAYG 104
            ||...:|..:|:    |.| ||..|:.:.:.::...|.|....::.|.|.|:..|......|..|
Human    64 RQTPHKPFLLFR----DET-LTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLG 123

  Fly   105 CLFNGTPFHAVNPNLEHNTISSLYKITRPRILCCDTADYEKIKDIGASL-----GALIITVNGKL 164
            .:..|.....:|.|:...::...::....::|.........:::|..||     ....::.....
Human   124 LVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNT 188

  Fly   165 PGVIS----VADILQNPLPDDYE-------PAQFQRGVDRTMAILCSSGTTGTPKAVTLSNSRKL 218
            .|:.|    |.::...|:|:.:.       ||.:          :.:|||||.|||..:::.|..
Human   189 DGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALY----------IYTSGTTGLPKAAMITHQRIW 243

  Fly   219 F----EMHSYLGSDDVQYAPSTLDWLTGLITLVTAAVFGTVRLISSEMFSTAHFLDICEQHEVSW 279
            :    ...|.|.:|||.|..........|:..:...:.....|.....||.:.|.|.|.::.|:.
Human   244 YGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDDCRKYNVTV 308

  Fly   280 TIMANSHVAMLANCPKTSAQKLRSLKH-LLFAGGHCLVATLKKMQSFLHGSGILRNAYGLTEVGT 343
            .......:..|.|.|    ||.....| :..|.|:.|...:.:......|...:...|..|| |.
Human   309 IQYIGELLRYLCNSP----QKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATE-GN 368

  Fly   344 LVSYNYDTQSKPTSVGRLMANIRVKIV----------------DSSGQ-LQGPKG-LGEILCHNG 390
            :...||  ..|..:||| :..::.||:                |.:|. ::.||| :|.::|...
Human   369 IGFMNY--ARKVGAVGR-VNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKIT 430

  Fly   391 Q--PWSGYVGNPLAT--AEMRD--SAG--WYHTGDVGYFDEDHYLHIVERKKDMLKYLGMMYYPH 447
            |  |::||.|....|  .::||  ..|  ::::||:...|.:::::..:|..|..::.|......
Human   431 QLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATT 495

  Fly   448 EVEEVIAQMPDVAEVCVFGI-FRETEGDAAAASVVLRSGSKLDPK----HVEQYVRKNVSVQFKH 507
            ||.:.:..:..|.||.|:|: ..:.||....||:.::...:.|.|    |:..|:......:|..
Human   496 EVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLR 560

  Fly   508 LHGGVQFVPQLAKSANGKVNRQAVKAAYLRDA 539
            :...:: :....|.....:..:....|.::||
Human   561 IQDTIE-ITGTFKHRKMTLVEEGFNPAVIKDA 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11391NP_650830.1 CaiC 24..541 CDD:223395 118/552 (21%)
AFD_class_I 51..527 CDD:302604 111/527 (21%)
SLC27A2NP_003636.2 hsFATP2a_ACSVL_like 74..610 CDD:341261 115/542 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.