DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11391 and acsbg1

DIOPT Version :9

Sequence 1:NP_650830.1 Gene:CG11391 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:187 Identity:42/187 - (22%)
Similarity:63/187 - (33%) Gaps:54/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TRLTRFQMLQNAAKIGCYLRDQGFKKETDLVGLMARNSTHVGALAYGCLFNGTPFHAVNPNLEHN 122
            |.:..:::.:.|||....|..:.|..    ||::..||......|.|.:|.|            .
 Frog    75 TFMDYYKLCRQAAKSFLKLGLERFHS----VGILGFNSEEWFISAIGTVFAG------------G 123

  Fly   123 TISSLYKITRPR-------------ILCCDTADYEKIKDIGASLGALIITVNGKLPGVISVADIL 174
            .|:.:|....|.             |:..:....|||..|...|        ..|..|:.....|
 Frog   124 IITGIYTTNSPEACHYVASDCKMNIIVVENQKQLEKILQIWDGL--------PHLKAVVQYKGNL 180

  Fly   175 QNPLPDDYEPAQFQR-GVD----------------RTMAILCSSGTTGTPKAVTLSN 214
            |...|:.|...:|.. |.|                :...::.:|||||.||.|.||:
 Frog   181 QEKRPNLYTWEEFMEFGKDIADAHLDDIINSQKANQCCVLIYTSGTTGNPKGVMLSH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11391NP_650830.1 CaiC 24..541 CDD:223395 42/187 (22%)
AFD_class_I 51..527 CDD:302604 42/187 (22%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 42/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.