DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11659 and ACSM3

DIOPT Version :9

Sequence 1:NP_650829.1 Gene:CG11659 / 42352 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_024306135.1 Gene:ACSM3 / 6296 HGNCID:10522 Length:633 Species:Homo sapiens


Alignment Length:345 Identity:89/345 - (25%)
Similarity:160/345 - (46%) Gaps:46/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 NDQTLAILCSSGTTGTPKAVTITNSRHILA----GNY--HLTTADVQYSHNTLDWITGLLTTITS 245
            :::.:||..:|||:|.||....|:|...|.    |.:  .||.:||.:  ||.|  ||...:..|
Human   263 HNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMW--NTSD--TGWAKSAWS 323

  Fly   246 GVFS---------TTRIIADNAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDLSSLR 301
            .|||         |..:   ..|:|...|:.:.:|.:|.....|:...:::. .|..:....||:
Human   324 SVFSPWIQGACVFTHHL---PRFEPTSILQTLSKYPITVFCSAPTVYRMLVQ-NDITSYKFKSLK 384

  Fly   302 CYMFGGSRAALEVQKGIRSRLSHNCLQFVYGFTELGAMATINC-HFDE---KTGSVGQLVNGLKM 362
            ..:..|.....:|.:..|::...:..: .||.||    ..:.| :|..   |.||:|:......:
Human   385 HCVSAGEPITPDVTEKWRNKTGLDIYE-GYGQTE----TVLICGNFKGMKIKPGSMGKPSPAFDV 444

  Fly   363 KIKNDDGESLGPDEIGEVCI--MNNQH---WSGYYGNEVETRN-MRDSLGWYHSGDLGYMDRDGF 421
            ||.:.:|..|.|.:.|::.|  :.|:.   ::.|..|..:|.: :|.:  :|.:||.||||:||:
Human   445 KIVDVNGNVLPPGQEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGN--FYITGDRGYMDKDGY 507

  Fly   422 LYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVV-----KKLGS 481
            .:.:.|..:::........|.::|:.::|.|.|||..|......|.|:...|.||     |....
Human   508 FWFVARADDVILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQ 572

  Fly   482 ELEAQDVVDYVRSRTDSKYK 501
            |...:::.::|: :|.:.||
Human   573 EQLIKEIQEHVK-KTTAPYK 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11659NP_650829.1 CaiC 26..523 CDD:223395 89/345 (26%)
AFD_class_I 47..522 CDD:302604 89/345 (26%)
ACSM3XP_024306135.1 AFD_class_I 54..596 CDD:327384 89/345 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.