DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11659 and Slc27a3

DIOPT Version :9

Sequence 1:NP_650829.1 Gene:CG11659 / 42352 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_011238431.1 Gene:Slc27a3 / 26568 MGIID:1347358 Length:698 Species:Mus musculus


Alignment Length:340 Identity:77/340 - (22%)
Similarity:127/340 - (37%) Gaps:86/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 TLAILCSSGTTGTPKAVTITNSRHI-LAGNYHLT---TADVQYSHNTLDWITGLLTTITSGVFST 250
            |...:.:|||||.|||..|::.:.: ..|.|||.   ..||.|....|..::|.|.    |:...
Mouse   266 TCLYIFTSGTTGLPKAARISHLKVLQCQGFYHLCGVHQEDVIYLALPLYHMSGSLL----GIVGC 326

  Fly   251 TRIIADNAFDPAFALRII----EEYKVT-----------WTIQPPSSMALMINCPDFETCDLSSL 300
            ..|.|.....|.|:....    ::::||           ...||||.          ..||    
Mouse   327 LGIGATVVLKPKFSASQFWDDCQKHRVTVFQYIGELCRYLVNQPPSK----------AECD---- 377

  Fly   301 RCYMFGGSRAALEVQKGIR--------SRLSHNCLQFVYGFTELGAMATINCHFDEKTGSVGQ-- 355
                   .:..|.|..|:|        .|.....:...||.|| |.:||.|  :..:.|:||:  
Mouse   378 -------HKVRLAVGSGLRPDTWERFLRRFGPLQILETYGMTE-GNVATFN--YTGRQGAVGRAS 432

  Fly   356 ---------------LVNGLKMKIKNDDGESL--GPDEIGEVC--IMNNQHWSGYYG-NEVETRN 400
                           ::.|  ..|:|..|..:  .|.|.|.:.  :.....:.||.| .|:....
Mouse   433 WLYKHIFPFSLIRYDVMTG--EPIRNAQGHCMTTSPGEPGLLVAPVSQQSPFLGYAGAPELAKDK 495

  Fly   401 MRDSLGW-----YHSGDLGYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVF 460
            :...:.|     :::|||...|..|||:..||..:..:::.......::..|:..:..:.||.::
Mouse   496 LLKDVFWSGDVFFNTGDLLVCDEQGFLHFHDRTGDTFRWKGENVATTEVAEVLETLDFLQEVNIY 560

  Fly   461 GIWSNIFGDEAAAAV 475
            |:  .:.|.|..|.:
Mouse   561 GV--TVPGHEGRAGM 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11659NP_650829.1 CaiC 26..523 CDD:223395 77/340 (23%)
AFD_class_I 47..522 CDD:302604 77/340 (23%)
Slc27a3XP_011238431.1 AFD_class_I 87..609 CDD:388389 77/340 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.