DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11659 and ACSF3

DIOPT Version :9

Sequence 1:NP_650829.1 Gene:CG11659 / 42352 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_005256350.1 Gene:ACSF3 / 197322 HGNCID:27288 Length:610 Species:Homo sapiens


Alignment Length:530 Identity:109/530 - (20%)
Similarity:207/530 - (39%) Gaps:86/530 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TRGELLANAMRLASYMRSL-----GLLQSDIVGLIGRNTTHMLAVAYACFFNGIAFHSLNITYDR 117
            |..||.:.::||:..:..|     |.|:.:.|..:..|....:...:|.:.:|.....|...:..
Human    67 TYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGGVAVPLYRKHPA 131

  Fly   118 DTIEKIYKVTRPSIIFCDGDEFEKVRSATAELDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAK 182
            ..:|.:...::.|::....:..|.:.....:|.|.::     ||........|..|.|   .|..
Human   132 AQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVPLL-----PLTPAIYTGAVEEPAE---VPVP 188

  Fly   183 LEKGNDQTLAILCSSGTTGTPKAVTIT--NSRHILAGNYH----------LTTADVQYSHNTLD- 234
            .:...::...|:.:|||||.||.|..|  |.|.::.|..|          |....:.:.|..:: 
Human   189 EQGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHKWAWTKDDVILHVLPLHHVHGVVNA 253

  Fly   235 -----WITGLLTTITSGVFS------------TTRIIADNAF--DPAFALRIIEEYKVTWTIQPP 280
                 |:..  |.:....||            |.||   |.|  .|....:::|.|...:| ||.
Human   254 LLCPLWVGA--TCVMMPEFSPQQVWEKFLSSETPRI---NVFMAVPTIYTKLMEYYDRHFT-QPH 312

  Fly   281 SSMALMINCPDFETCDLSSLRCYMFGGSRAALEVQKGIRSRLSHNCLQFVYGFTELG-AMATINC 344
            :...|...|.:       .:|..:.|.:...|.|.:..::...|..|: .||.||:| |::....
Human   313 AQDFLRAVCEE-------KIRLMVSGSAALPLPVLEKWKNITGHTLLE-RYGMTEIGMALSGPLT 369

  Fly   345 HFDEKTGSVGQLVNGLKMKIKND-------------DGESLG-------PDEIGEVCIMNNQHWS 389
            ......||||..:.|::::|.::             :|:..|       .::.||:.:.....:.
Human   370 TAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEEKEGELLVRGPSVFR 434

  Fly   390 GYYGNEVETRNMRDSLGWYHSGDLGYMDRDGFLYIMDRKK-EMLKYQNIMYYPNDIESVISEMPQ 453
            .|:....||::.....||:.:||. .:.:||..:|..|.. :::|.........::|..:...|.
Human   435 EYWNKPEETKSAFTLDGWFKTGDT-VVFKDGQYWIRGRTSVDIIKTGGYKVSALEVEWHLLAHPS 498

  Fly   454 VAEVCVFGIWSNIFGDEAAAAVVKKLGSELEAQDVVDYVRSRTDSKYKQLNGGAVIVDDLQRSAN 518
            :.:|.|.|:....:|....|.|..:.|..|..:::.::.|.: :...|:.....:.:...:..|:
Human   499 ITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARLK-EHPTKRRENSILNIGRKRNLAS 562

  Fly   519 GK---TNRMA 525
            |.   |.|||
Human   563 GMRALTGRMA 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11659NP_650829.1 CaiC 26..523 CDD:223395 106/526 (20%)
AFD_class_I 47..522 CDD:302604 105/525 (20%)
ACSF3XP_005256350.1 MCS 55..546 CDD:341264 102/502 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.