DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11659 and ACSM6

DIOPT Version :9

Sequence 1:NP_650829.1 Gene:CG11659 / 42352 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_997204.2 Gene:ACSM6 / 142827 HGNCID:31665 Length:480 Species:Homo sapiens


Alignment Length:359 Identity:80/359 - (22%)
Similarity:135/359 - (37%) Gaps:53/359 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDEFEKVRSATAE---LDVK-IVTMR 157
            :..||...||.|...:.......|....::::...|..:......|.||.::   |..| :|:.:
Human   127 ICLACVRLGITFVPGSPQLTAKKIRYQLRMSKAQCIVANEAMAPVVNSAVSDCPTLKTKLLVSDK 191

  Fly   158 NHP--LDSIKIDEVVATPIEENFQPAKLEKGNDQTLAILCSSGTTGTPKAVTITNSRHILAGNYH 220
            ::.  ||..|:.:|  .|.::.:...|    :...:||..:.||||.||.|..:        .|.
Human   192 SYDGWLDFKKLIQV--APPKQTYMRTK----SQDPMAIFFTKGTTGAPKMVEYS--------QYG 242

  Fly   221 LTTADVQYSHNTLD-------WITGLLTTITSGVFSTTRIIAD------------NAFDPAFALR 266
            |.....|.|...:|       |..|   ....|..|.:.::..            ..|.|...|.
Human   243 LGMGFSQASRRWMDLQPTDVLWSLG---DAFGGSLSLSAVLGTWFQGACVFLCHMPTFCPETVLN 304

  Fly   267 IIEEYKVTWTIQPPSSMALMINCPDFETCDLSSLR-CYMFGG--SRAALEVQKGIRSRLSHNCLQ 328
            ::..:.:|.....|.....::....|.:....||: |...||  |...:|..|    |::...:.
Human   305 VLSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISPGVIEDWK----RITKLDIY 365

  Fly   329 FVYGFTELGAMATINCHFDEKTGSVGQLVNGLKMKIKNDDGESLGPDEIGEVC--IMNNQHWSGY 391
            ..||.||.|.:...:.....|..|:|:.:....::|.:::...|.|.|.|.:.  |..||..|.|
Human   366 EGYGQTETGLLCATSKTIKLKPSSLGKPLPPYIVQIVDENSNLLPPGEEGNIAIRIKLNQPASLY 430

  Fly   392 YGNEVETRNMRDSLG--WYHSGDLGYMDRDGFLY 423
            ..:.|.......:.|  .|.:||.|.||.||:.:
Human   431 CPHMVSWEEYASARGHMLYLTGDRGIMDEDGYFW 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11659NP_650829.1 CaiC 26..523 CDD:223395 80/359 (22%)
AFD_class_I 47..522 CDD:302604 80/359 (22%)
ACSM6NP_997204.2 AFD_class_I 45..480 CDD:302604 80/359 (22%)
AMP-binding 76..472 CDD:278902 80/359 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.