DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11659 and acsbg1

DIOPT Version :9

Sequence 1:NP_650829.1 Gene:CG11659 / 42352 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:234 Identity:43/234 - (18%)
Similarity:87/234 - (37%) Gaps:50/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DQKIWSGE---PVVKYFD-----PDLSIGEIIFHEMRRHPQLTAQISATEG-----TVLTRGELL 63
            ::|:|:.|   .|....|     ..:::.::....:.::..|.|..:...|     |.:...:|.
 Frog    19 EEKLWTTEANGSVQLRIDALCPQSPITVHQMFLESVDKYGPLDALSTKRNGIWEHVTFMDYYKLC 83

  Fly    64 ANAMRLASYMRSLGLLQSDIVGLIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTR 128
            ..|.:  |::: |||.:...||::|.|:......|....|.|.....:..|...:....:....:
 Frog    84 RQAAK--SFLK-LGLERFHSVGILGFNSEEWFISAIGTVFAGGIITGIYTTNSPEACHYVASDCK 145

  Fly   129 PSIIFCDGD-EFEKVRS-------ATAELDVKIVTMRNHP--------------LDSIKIDEVVA 171
            .:||..:.. :.||:..       ..|.:..|.......|              :....:|::: 
 Frog   146 MNIIVVENQKQLEKILQIWDGLPHLKAVVQYKGNLQEKRPNLYTWEEFMEFGKDIADAHLDDII- 209

  Fly   172 TPIEENFQPAKLEKGNDQTLAILCSSGTTGTPKAVTITN 210
                 |.|.|      :|...::.:|||||.||.|.:::
 Frog   210 -----NSQKA------NQCCVLIYTSGTTGNPKGVMLSH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11659NP_650829.1 CaiC 26..523 CDD:223395 39/217 (18%)
AFD_class_I 47..522 CDD:302604 37/191 (19%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 36/187 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.