DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6300 and Acsm1

DIOPT Version :9

Sequence 1:NP_650828.1 Gene:CG6300 / 42351 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001101972.2 Gene:Acsm1 / 361638 RGDID:1306813 Length:577 Species:Rattus norvegicus


Alignment Length:541 Identity:124/541 - (22%)
Similarity:198/541 - (36%) Gaps:128/541 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ELLANAMRLAS-YMRSLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAF-------HSLNITYDR 117
            ||...:.|.|: :.::.||...|.:.:|.........|...|...|:.|       .:.:|.|..
  Rat    90 ELRDLSRRAANVFEQTCGLQHGDRLALILPRVPEWWLVTVGCIRTGVIFIPGTAQMKAKDILYRI 154

  Fly   118 DTIEKIYKVTRPSIIFCDGDEFEKVRSATAELDVKIVTM-RNHPLDSIKIDEVVATPIEE---NF 178
            ...:....||..|::    .|.|.|.|....|..|||.. .||                |   ||
  Rat   155 QMSQAKAIVTTDSLV----PEVESVASECPGLKTKIVVSDHNH----------------EGWLNF 199

  Fly   179 QPAKLEKGNDQT---------LAILCSSGTTGTPKAV----------TITNSRHILAGNYHLTTA 224
            :........|.|         :.|..:|||||.||..          ::.:.|..|    .|.|:
  Rat   200 RTLLRSASPDHTCVKSKMKDPMVIFFTSGTTGYPKMAKHNQGLAFRSSVPSCRKFL----KLKTS 260

  Fly   225 DVQYSHNTLDWITG----LLTTITSGVFSTTRIIADN--AFDPAFALRIIEEYKVTWTIQPPS-- 281
            ||.:..:...||..    ||...|:|    ..:...|  .|||...:..:.:|.:|..:..|:  
  Rat   261 DVIWCMSDPGWILATVGCLLEPWTAG----ATVFVHNLPQFDPKVIVETLFKYPITQCLAAPAVY 321

  Fly   282 SMALMINC-----PDFETCDMSSLRCYMFGGSRAALEVQKGIRSRLS---HDCLQFVYGFTELGA 338
            .|.|..|.     |..|.|        ..||.....|..:..:.|..   |:    |||.:|.|.
  Rat   322 RMVLQKNISNLRFPTLEHC--------ATGGESLLPEEYEQWKQRTGLSIHE----VYGQSETGI 374

  Fly   339 MATINCHFDEKTGSVGQLVNGLKMKIINDDGESLGPDEIGEVCIMNNQHWSGYYGNEVE-TRNMR 402
            ...|......|.||:|:.:....::||::.|..|.|:.            .||.|..:: ||.:.
  Rat   375 TCAIFREMKVKRGSIGKAILPFDIQIIDEKGNILPPNT------------EGYIGIRIKPTRPLG 427

  Fly   403 DSLGW---------------YHSGDLGYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMP 452
            ..:|:               |:|||...:|.||:::.:.|..:::........|.::|:.:.|.|
  Rat   428 LFVGYENSPEKTSEVECGDFYNSGDRATIDEDGYIWFLGRSDDVINASGYRIGPTEVENALVEHP 492

  Fly   453 QVAEVCVFGIWSNIFGDEAAAAVVKKLGSELEAQD-------VVDYVRSRTDSKYKQLNGGAVIV 510
            .|:|..|........|:...|.:|  |..|..:.|       :.::|:|.| :.||... ....|
  Rat   493 AVSESAVVSSPDKDRGEVVKAFIV--LNPEFLSHDQEQLIKELQEHVKSVT-APYKYPR-KVEFV 553

  Fly   511 DDLQRSANGKTNR--MANKAY 529
            .:|.::..||..|  :.||.:
  Rat   554 SELPKTITGKIKRKELRNKEF 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 121/531 (23%)
AFD_class_I 47..522 CDD:302604 121/530 (23%)
Acsm1NP_001101972.2 AFD_class_I 46..573 CDD:302604 123/538 (23%)
Acs 46..570 CDD:223442 122/535 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.