DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6300 and mec-18

DIOPT Version :9

Sequence 1:NP_650828.1 Gene:CG6300 / 42351 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_508731.3 Gene:mec-18 / 180701 WormBaseID:WBGene00003179 Length:638 Species:Caenorhabditis elegans


Alignment Length:440 Identity:113/440 - (25%)
Similarity:190/440 - (43%) Gaps:91/440 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 EKIYKVTRPSIIFCDGDEFEKVRSATAELDVKIVTMRNHPLDSIKID-EVVATPIEENFQPAKLE 184
            |.|..:|.|         ..:|...:.||        |..::|..:| |.|.|||:        :
 Worm   195 EDIADLTSP---------VSEVSGQSKEL--------NGDVESSVVDSEEVQTPIQ--------Q 234

  Fly   185 KGNDQTLAILCSSGTTGTPKAVTI---------------------TNSRHIL----AGNYHLTTA 224
            ......|.||.:|||||..||..:                     |..|.:|    |..|.:.:|
 Worm   235 VSGQNPLLILFTSGTTGLAKAAELSHRSLIINIQQISLPLYGPVQTKERFLLPLSIAHIYGIVSA 299

  Fly   225 DVQYSHNTLDWITG----LLTTITSGVFSTTRIIADNAFD-----PAFALRIIEEYKVTWTIQPP 280
              .|:     .|.|    |::..::.:|..|  :.:|..:     ||.         |.|     
 Worm   300 --YYA-----LINGASLYLISKQSNRLFMET--LVNNQINVMHITPAI---------VHW----- 341

  Fly   281 SSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGIRSRLSHDCLQFVYGFTELGAMATINCH 345
              ||......|::|.::.|:.|   .|:.........::|||:....:..:|.||||.:.|::.:
 Worm   342 --MATDAIVDDYKTPNLRSVLC---AGAPIDSNSAAAMKSRLNIKDFRQSFGMTELGGICTMSPY 401

  Fly   346 FDEKTGSVGQLVNGLKMKIINDDGESLG-PDEIGEVCIMNNQHWSGYYGNEVETRNMRDSLGWYH 409
            .|||..|||..:.|:..|::|.:.:.|. |.:.|::.::..|....||.|...|..:.|:.|:..
 Worm   402 LDEKIESVGNPLPGMLFKVVNWETKQLCLPRQPGQIIVLGPQVSPCYYKNPKATSELFDATGFVK 466

  Fly   410 SGDLGYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAA 474
            :||.|:.|..|.:|::||.|:::|.:..|..|:::|.|:.....:.:..|.|...::.|:..||.
 Worm   467 TGDAGFYDEVGRIYVLDRIKDIIKCKGTMICPSEVELVLRAHAGIDDCAVVGRQDHVTGEVPAAF 531

  Fly   475 VVKKLGSELEAQ-DVVDYVRSRTDSKYKQLNGGAVIVDDLQRSANGKTNR 523
            |||.....|.|. :|..||..:. :.:|:|.||...:.::.||..||..|
 Worm   532 VVKNAQHPLLASAEVRQYVSGKI-ATFKELRGGVFFISEIPRSVCGKILR 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 112/438 (26%)
AFD_class_I 47..522 CDD:302604 112/437 (26%)
mec-18NP_508731.3 CaiC 12..585 CDD:223395 113/440 (26%)
AFD_class_I 35..579 CDD:302604 112/437 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.