DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6300 and ACSM6

DIOPT Version :9

Sequence 1:NP_650828.1 Gene:CG6300 / 42351 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_997204.2 Gene:ACSM6 / 142827 HGNCID:31665 Length:480 Species:Homo sapiens


Alignment Length:378 Identity:85/378 - (22%)
Similarity:142/378 - (37%) Gaps:53/378 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDEFEKV 142
            |...|.:.||...|.....:..||...||.|...:.......|....::::...|..:......|
Human   108 LSHGDRLMIILPPTPEAYWICLACVRLGITFVPGSPQLTAKKIRYQLRMSKAQCIVANEAMAPVV 172

  Fly   143 RSATAE---LDVK-IVTMRNHP--LDSIKIDEVVATPIEENFQPAKLEKGNDQTLAILCSSGTTG 201
            .||.::   |..| :|:.:::.  ||..|:.:|  .|.::.:...|    :...:||..:.||||
Human   173 NSAVSDCPTLKTKLLVSDKSYDGWLDFKKLIQV--APPKQTYMRTK----SQDPMAIFFTKGTTG 231

  Fly   202 TPKAVTITNSRHILAGNYHLTTADVQYSHNTLD-------WITGLLTTITSGVFSTTRIIAD--- 256
            .||.|..:        .|.|.....|.|...:|       |..|   ....|..|.:.::..   
Human   232 APKMVEYS--------QYGLGMGFSQASRRWMDLQPTDVLWSLG---DAFGGSLSLSAVLGTWFQ 285

  Fly   257 ---------NAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLR-CYMFGG--SR 309
                     ..|.|...|.::..:.:|.....|.....::....|.:....||: |...||  |.
Human   286 GACVFLCHMPTFCPETVLNVLSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISP 350

  Fly   310 AALEVQKGIRSRLSHDCLQFVYGFTELGAMATINCHFDEKTGSVGQLVNGLKMKIINDDGESLGP 374
            ..:|..|    |::...:...||.||.|.:...:.....|..|:|:.:....::|::::...|.|
Human   351 GVIEDWK----RITKLDIYEGYGQTETGLLCATSKTIKLKPSSLGKPLPPYIVQIVDENSNLLPP 411

  Fly   375 DEIGEVC--IMNNQHWSGYYGNEVETRNMRDSLG--WYHSGDLGYMDRDGFLY 423
            .|.|.:.  |..||..|.|..:.|.......:.|  .|.:||.|.||.||:.:
Human   412 GEEGNIAIRIKLNQPASLYCPHMVSWEEYASARGHMLYLTGDRGIMDEDGYFW 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 85/378 (22%)
AFD_class_I 47..522 CDD:302604 85/378 (22%)
ACSM6NP_997204.2 AFD_class_I 45..480 CDD:302604 85/378 (22%)
AMP-binding 76..472 CDD:278902 85/378 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.