DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6300 and ACSM2A

DIOPT Version :9

Sequence 1:NP_650828.1 Gene:CG6300 / 42351 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001295101.1 Gene:ACSM2A / 123876 HGNCID:32017 Length:577 Species:Homo sapiens


Alignment Length:513 Identity:119/513 - (23%)
Similarity:203/513 - (39%) Gaps:68/513 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ELLANAMRLASYMR-SLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITY-DRDTIEKI 123
            ||..|:.:.|:.:. :.||.:.|.|.::.........|...|...|:.|....|.. ..|.:.::
Human    85 ELSENSQQAANVLSGACGLQRGDRVAVVLPRVPEWWLVILGCIRAGLIFMPGTIQMKSTDILYRL 149

  Fly   124 YKVTRPSIIFCDG--DEFEKVRSATAELDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAKLEKG 186
            ......:|:..|.  .|.:.|.|....|.:|::.........:...:::.   |.:.....:|.|
Human   150 QMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLN---EASTTHHCVETG 211

  Fly   187 NDQTLAILCSSGTTGTPKAVTITNSRHIL-----AGNYHLTTADVQYSHNTLDWITGLLTTITS- 245
            :.:..||..:|||:|.||....:.|...|     ||...|..:|:.::.:...||..:|.::.. 
Human   212 SQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILCSLMEP 276

  Fly   246 ---GVFSTTRIIADNAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCDMSSLR------ 301
               |..:...::.  .|||...|:.:..|.:...:..|....:::.      .|:||.:      
Human   277 WALGACTFVHLLP--KFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ------QDLSSYKFPHLQN 333

  Fly   302 CYMFGGS--RAALE---VQKGIRSRLSHDCLQFVYGFTELGAMATINCHFDEKTGSVGQLVNGLK 361
            |...|.|  ...||   .|.|:..|.|       ||.||.|....::.....|.|.:|...:...
Human   334 CVTVGESLLPETLENWRAQTGLDIRES-------YGQTETGLTCMVSKTMKIKPGYMGTAASCYD 391

  Fly   362 MKIINDDGESLGPDEIGEVCIMNNQ-----HWSGYYGNEVET-RNMRDSLGWYHSGDLGYMDRDG 420
            ::||:|.|..|.|...|::.|....     .:|||..|..:| .|:|... |. .||.|..|.||
Human   392 VQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGDF-WL-LGDRGIKDEDG 454

  Fly   421 FLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVVKKLGSELEA 485
            :...|.|..:::........|:::|:.:.|.|.|.|..|......:.|:...|.||  |.|:..:
Human   455 YFQFMGRANDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVV--LASQFLS 517

  Fly   486 QD-------VVDYVRSRTDSKYKQ-------LNGGAVIVDDLQRS-ANGKTNRMANKA 528
            .|       :..:|:|.| :.||.       ||....:...:||: ...|..:|:.||
Human   518 HDPEQLTKELQQHVKSVT-APYKYPRKIEFVLNLPKTVTGKIQRAKLRDKEWKMSGKA 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 116/506 (23%)
AFD_class_I 47..522 CDD:302604 116/505 (23%)
ACSM2ANP_001295101.1 AFD_class_I 40..568 CDD:388389 116/505 (23%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 469..471 0/1 (0%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19345228 540..542 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.