DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6300 and SLC27A3

DIOPT Version :9

Sequence 1:NP_650828.1 Gene:CG6300 / 42351 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_077306.3 Gene:SLC27A3 / 11000 HGNCID:10997 Length:683 Species:Homo sapiens


Alignment Length:448 Identity:96/448 - (21%)
Similarity:162/448 - (36%) Gaps:128/448 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 HPLDSIKIDEVVATPIEENFQPAKLEKGNDQTLAILC----SSGTTGTPKAVTITNSRHI-LAGN 218
            ||..   |.:::|....|...|......:.|::...|    :|||||.|||..|::.:.: ..|.
Human   250 HPAG---ISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARISHLKILQCQGF 311

  Fly   219 YHLT---TADVQYSHNTLDWITGLLTTITS--GVFSTTRIIADNAFDPAFALRIIEEYKVT---- 274
            |.|.   ..||.|....|..::|.|..|..  |:.:|  ::..:.|.........::::||    
Human   312 YQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGAT--VVLKSKFSAGQFWEDCQQHRVTVFQY 374

  Fly   275 -------WTIQPPSSMALMINCPDFETCDMSSLRCYMFGGSRAALEVQKGIRSRLSHDCLQFV-- 330
                   ...||||...                     .|.:..|.|..|:|.....   :||  
Human   375 IGELCRYLVNQPPSKAE---------------------RGHKVRLAVGSGLRPDTWE---RFVRR 415

  Fly   331 ---------YGFTELGAMATINCHFDEKTGSVGQ----LVNGLKMKIINDD---GESL------- 372
                     ||.|| |.:||||  :..:.|:||:    ..:.....:|..|   ||.:       
Human   416 FGPLQVLETYGLTE-GNVATIN--YTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHC 477

  Fly   373 ---GPDEIGEVC--IMNNQHWSGYYGNE--VETRNMRDSLG----WYHSGDLGYMDRDGFLYIMD 426
               .|.|.|.:.  :.....:.||.|..  .:.:.::|...    ::::|||...|..|||...|
Human   478 MATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRFHD 542

  Fly   427 RKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDE---AAAAVVKKLGSELE---- 484
            |..:..:::.......::..|...:..:.||.|:|:  .:.|.|   ..||:|.:....|:    
Human   543 RTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGV--TVPGHEGRAGMAALVLRPPHALDLMQL 605

  Fly   485 ----AQDVVDYVRSR---------TDSKYKQLNGGAVIVDDLQRSANGKTNRMANKAY 529
                ::::..|.|.|         |...:||                 :..||||:.:
Human   606 YTHVSENLPPYARPRFLRLQESLATTETFKQ-----------------QKVRMANEGF 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6300NP_650828.1 CaiC 26..523 CDD:223395 92/440 (21%)
AFD_class_I 47..522 CDD:302604 92/439 (21%)
SLC27A3NP_077306.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..145
hsFATP2a_ACSVL_like 163..673 CDD:213304 96/448 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.