DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluClalpha and nAChRalpha1

DIOPT Version :9

Sequence 1:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001262916.1 Gene:nAChRalpha1 / 42918 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster


Alignment Length:370 Identity:88/370 - (23%)
Similarity:161/370 - (43%) Gaps:75/370 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSGHYFWAILYFASLCSASLANNAKINFREKEKKVLDQILGAGKYDARIRPSGINGTDGPAVVR 65
            ||| ..|.|:.......:..|||       ...|::.|.:|  ..|:..|||.| |.:|.   :.
  Fly     1 MGS-VLFAAVFIALHFATGGLAN-------PDAKRLYDDLL--SNYNRLIRPVG-NNSDR---LT 51

  Fly    66 VNIFVRSISKIDDVTMEYSVQLT---FREQWTDERLKFD-DIQGRLKYLTLTEANRVWMPDLFFS 126
            |.:.:| :|::.||.::..:..|   ..::|.|.:||:: |..|.:..|.: .:..:|:||:...
  Fly    52 VKMGLR-LSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHV-PSEHIWLPDIVLY 114

  Fly   127 NEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTN-- 189
            |..:|::...||....:.  ..|.|::.........|.::::.:|.|.|.|.::..|  ||.:  
  Fly   115 NNADGNYEVTIMTKAILH--HTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGS--WTYDGY 175

  Fly   190 --DLVFLWK--EGDPVQVVKNL------------HLPRFTLEKFLTDYCNSKTNTGEYSCLK--- 235
              ||..|.:  :.|.::|..:|            .:|....|||             |||.:   
  Fly   176 MVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKF-------------YSCCEEPY 227

  Fly   236 VDLLF----KREFSYYLIQIYIPCCMLVIVSWVSFWL--DQGAVPARVSLGVTTLLTMATQTSGI 294
            :|::|    :|:..:|.:.:.|||..:..:|.:.|:|  |.|   .::||.::.||::......:
  Fly   228 LDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSG---EKISLCISILLSLTVFFLLL 289

  Fly   295 NASLPPVSYTKAIDVWTGVCLTF-----VFGALLEFALVNYASRS 334
            ...:||.|.|..:   .|..|.|     ....::..|::|...||
  Fly   290 AEIIPPTSLTVPL---LGKYLLFTMMLVTLSVVVTIAVLNVNFRS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 86/368 (23%)
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 56/239 (23%)
LIC 27..530 CDD:273305 79/336 (24%)
Neur_chan_memb 247..530 CDD:280999 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.