DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluClalpha and Gabra5

DIOPT Version :9

Sequence 1:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_058991.2 Gene:Gabra5 / 29707 RGDID:61859 Length:464 Species:Rattus norvegicus


Alignment Length:449 Identity:160/449 - (35%)
Similarity:241/449 - (53%) Gaps:69/449 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KVLDQILGAGKYDARIRPSGINGTDGPAV--VRVNIFVRSISKIDDVTMEYSVQLTFREQWTDER 97
            ::||.:|..  ||.|:|| |:    |..:  ||.:|:|.|...:.|..|||::.:.||:.|.|||
  Rat    51 RILDGLLDG--YDNRLRP-GL----GERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDER 108

  Fly    98 LKFDDIQGRLKYLTLTE--ANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLT 160
            |:|   :|.::.|.|..  |:::|.||.||.|.|:...||:..||..:|:..:|::||::|::::
  Rat   109 LRF---KGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTIS 170

  Fly   161 LACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVV--------KNLHLPRFTLEKF 217
            ..|||.|:.:|:|...|.|:..||.:..:::|::|..|....||        ...||...|:.  
  Rat   171 AECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-- 233

  Fly   218 LTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVT 282
             |:  |..|:||||:.:......||:..|::||.|:||.|.||:|.|||||::.:||||...|||
  Rat   234 -TE--NISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVT 295

  Fly   283 TLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSG---SNKANMHKE 344
            |:|||.|.:.....|||.|:|..|:|.:..||..|||.||:|||.|||.::.|   ..|..:...
  Rat   296 TVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA 360

  Fly   345 NMKKKRRDLEQASLDAASDLLDTDSNATFAMASQFARGGGQQKPLVRHPGDPLALEKRL------ 403
            .:|||.|:|          :|:..:||       |..|      .:.||  |...:::|      
  Rat   361 KIKKKEREL----------ILNKSTNA-------FTTG------KLTHP--PNIPKEQLPGGTGN 400

  Fly   404 ---QCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYLFRE 459
               ...:.....|.....||:.|     ..:||.:|||.||::|..||||||:|||.||
  Rat   401 AVGTASIRASEEKTSESKKTYNS-----ISKIDKMSRIVFPILFGTFNLVYWATYLNRE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 155/443 (35%)
Gabra5NP_058991.2 LIC 15..450 CDD:273305 155/443 (35%)
LGIC_ECD_GABAAR_A5 58..256 CDD:349839 70/212 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..414 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.