DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluClalpha and GABRR3

DIOPT Version :10

Sequence 1:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001099050.1 Gene:GABRR3 / 200959 HGNCID:17969 Length:467 Species:Homo sapiens


Alignment Length:160 Identity:34/160 - (21%)
Similarity:65/160 - (40%) Gaps:25/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFHLVSAVLYAAVCYRDTTIVTGALLPIPYQTWSRFVWLTIIDLYMQLLYHTIGFILAVVSPNKR 69
            :|...||.|...:..  |..:|..:|| ..|::|...       |.:|.||....:.:..:|...
Human   276 LFSSRSACLLGLLAI--TNALTNGVLP-AVQSFSCLP-------YGRLAYHLAVVLGSCANPLAC 330

  Fly    70 HIIFDYWARALTGPIGVAVTVLFWGLFLFDPATLA------RDEMAMKILTLFWFNHGLHTLPAI 128
            .:......|:|.|..|:::..:..|.:|...|.|:      .....:.::.|.|      .|.|.
Human   331 FLAMAVLCRSLAGLCGLSLLGMLLGSYLMTLAALSPCPPLVGTSAGVVLVVLSW------VLCAG 389

  Fly   129 T-AHLDLAIYN--HTSFSTSAILKGIAVFV 155
            | :::.:||.:  |:....:.:..|:|:.|
Human   390 TFSYIKVAISSMLHSGGRPALLAAGVAIQV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 34/160 (21%)
GABRR3NP_001099050.1 LIC 55..466 CDD:455710 34/160 (21%)
LGIC_ECD_GABAAR_rho 82..267 CDD:349806
Cys-loop 184..198 CDD:349806
Interaction with SQSTM1. /evidence=ECO:0000250|UniProtKB:P50573 347..448 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.