DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluClalpha and LOC100001259

DIOPT Version :9

Sequence 1:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_021336767.1 Gene:LOC100001259 / 100001259 -ID:- Length:369 Species:Danio rerio


Alignment Length:306 Identity:121/306 - (39%)
Similarity:182/306 - (59%) Gaps:13/306 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLK 99
            ::||::|..  ||.|:|| |:.  |....|:.:|:|.|...:.|..|||::.:.||:.|.|||||
Zfish    41 RILDRLLDG--YDNRLRP-GLG--DRVTTVKTDIYVTSFGPVSDTDMEYTIDVFFRQSWKDERLK 100

  Fly   100 FDDIQGRLKYLTLTE--ANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLA 162
            |   :|.:..|.|..  |:::|.||.||.|.|:...||:.|||..:||..:|::||::|:::...
Zfish   101 F---EGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVHAE 162

  Fly   163 CPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFLTDYCNSKT- 226
            |||:|:.:|:|...|.|:..||.:||.::.:.|.:.....||......|......|.....::| 
Zfish   163 CPMHLEDFPMDFHSCPLKFGSYAYTTTEVTYTWTKNASNSVVVEEESSRLNQYDLLGQTVGNETI 227

  Fly   227 --NTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMAT 289
              :||||:.:......||:..|::||.|:||.|.||:|.|||||::.:||||...||||:|||.|
Zfish   228 RSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTT 292

  Fly   290 QTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSG 335
            .:.....|||.|:|..|:|.:..||..|||.||:|||.|||.::.|
Zfish   293 LSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 121/306 (40%)
LOC100001259XP_021336767.1 Neur_chan_LBD 7..>350 CDD:332142 121/306 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.