DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and NIC3

DIOPT Version :10

Sequence 1:NP_732446.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_197713.1 Gene:NIC3 / 832386 AraportID:AT5G23220 Length:198 Species:Arabidopsis thaliana


Alignment Length:206 Identity:43/206 - (20%)
Similarity:72/206 - (34%) Gaps:76/206 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VNAFLIVDVQNDFISGSLDISNCSAQQQGHEILEPI-NKLLDTVDF-----DAVFYSLDWH--PS 152
            :.|.|::|:||.|.|                :.:|| |.:|.|:|.     ..||::...|  |:
plant    20 IAALLVIDMQNHFSS----------------MAKPILNNVLTTIDICRRASVPVFFTRHNHKSPT 68

  Fly   153 DHVSFID----NVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDL 213
            ||....:    :|.:....:|..:.....:|      .||..|.::                   
plant    69 DHGMLGEWCNGDVILDGTTDSEIIQEIQGQV------TGPDEMVEK------------------- 108

  Fly   214 KVVDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDAL 278
                             ::||.|  ||    |.|...|:..|..::.|.|:..::|...||.:|.
plant   109 -----------------NTYSAF--NK----TRLQENLEKIGVKEVIVIGVMTNLCCETTAREAF 150

  Fly   279 SAGYRTILIDD 289
            ..|:|.....|
plant   151 IKGFRVFFSTD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_732446.1 FRQ1 <11..82 CDD:444056
nicotinamidase 97..315 CDD:238493 43/205 (21%)
NIC3NP_197713.1 PLN02621 1..198 CDD:178229 43/206 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.