DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and Isoc2b

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_006540391.1 Gene:Isoc2b / 67441 MGIID:1914691 Length:212 Species:Mus musculus


Alignment Length:126 Identity:26/126 - (20%)
Similarity:54/126 - (42%) Gaps:14/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 TNPEVDSYSVFWDNKKLSDTT------LNAQL-KMKGATDIYVCGLAYDVCVGATAVDALSAGYR 283
            |.||:.:..:    :.:|.|:      |..:| |:.....:.:||:....|:..||:|.|..|.:
Mouse    70 TVPELGAQGL----RTMSKTSFSMVPPLQQELDKLPQLQSVLLCGIETQGCILHTALDLLDRGLQ 130

  Fly   284 T-ILIDDCCRGTDVHDIEHTKEKVNTSDGVIVHTNQVKAMAEGRDRRPELGYKLAMELKSP 343
            . :.:|.|...::::.:......  ...||.:.|::|..:...:|.......::...||.|
Mouse   131 VHVAVDACSSQSEMNRLVALARM--QQSGVFLSTSEVLILQLVKDAAHPQFKEIQKILKEP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 20/96 (21%)
Isoc2bXP_006540391.1 cysteine_hydrolases 20..172 CDD:381872 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.