DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and ISOC1

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_057132.2 Gene:ISOC1 / 51015 HGNCID:24254 Length:298 Species:Homo sapiens


Alignment Length:370 Identity:69/370 - (18%)
Similarity:121/370 - (32%) Gaps:138/370 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPTPPIVIEDSNGSAMDACFTAFDKDSDDRLSL---AEFSIICRALFRNDKGHIYDVPPERLEQI 64
            |.|.|::.          ||:.|.:.|    |:   |.:.::.:. |.:..|...|:..:.:.|:
Human    23 SGTVPVLF----------CFSVFARPS----SVPHGAGYELLIQK-FLSLYGDQIDMHRKFVVQL 72

  Fly    65 FAVFDTNGDGFIDREEFKFCWNQWIKTIVRPVNAFLIVDVQNDFISGSLDISNCSAQQQGHEILE 129
            ||            ||    |.|::                 |...|......|..:      |.
Human    73 FA------------EE----WGQYV-----------------DLPKGFAVSERCKVR------LV 98

  Fly   130 PINKLLDTVDFDAVFYSLDWHPSDHVSFIDNV--KMRPMDESSALDSDSAKVFDTVIFAGPPPMK 192
            |:...|.|:.        :..||..|.|..::  :.||          :.|.|..:|..|     
Human    99 PLQIQLTTLG--------NLTPSSTVFFCCDMQERFRP----------AIKYFGDIISVG----- 140

  Fly   193 QRLWPRH-------CVQDSWGAELHKDLKVVD-HGIKV------YKGTNPEVDSYSVFWDNKKLS 243
            |||....       .|.:.:...|...::.:| .|:|:      :....|||::           
Human   141 QRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEA----------- 194

  Fly   244 DTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIEHTKEK--- 305
                 |..::.|...:.:.|:...||:..||::.:..|....::.|......:.|.....|:   
Human   195 -----ALAEIPGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVADATSSRSMMDRMFALERLAR 254

  Fly   306 ----VNTSDGVIVH-------------TNQVKAMAEGRDRRPELG 333
                |.||:.|::.             .|.:||.|      ||.|
Human   255 TGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASA------PESG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008 13/63 (21%)
EF-hand_7 21..82 CDD:290234 14/63 (22%)
nicotinamidase 97..315 CDD:238493 43/240 (18%)
ISOC1NP_057132.2 YcaC_related 116..270 CDD:238494 34/184 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.