DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and Isoc1

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001014264.2 Gene:Isoc1 / 364879 RGDID:1307632 Length:297 Species:Rattus norvegicus


Alignment Length:362 Identity:65/362 - (17%)
Similarity:116/362 - (32%) Gaps:132/362 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNGSAMDACFTAFDKDSDDRLSL---AEFSIICRALFRNDKGHIYDVPPERLEQIFAVFDTNGDG 74
            |.|..:..||:.|.:.:    |:   |.:.::.:. |.:..|...|:..:.:.|:||        
  Rat    22 SGGVPVLFCFSVFARPA----SVPHGAGYDVLIQK-FLSLYGDQLDMHRKFVVQLFA-------- 73

  Fly    75 FIDREEFKFCWNQWIKTIVRPVNAFLIVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDTVD 139
                ||    |.|::                 |...|......|..:      |.|:...|.|:.
  Rat    74 ----EE----WGQYV-----------------DLPKGFAVSERCKLR------LVPLQIQLTTLG 107

  Fly   140 F----DAVFYSLDWHPSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRH- 199
            .    ..||:..|...          :.||          :.|.|..:|..|     |||.... 
  Rat   108 NLTPPSTVFFCCDMQE----------RFRP----------AIKYFGDIISVG-----QRLLQGAR 147

  Fly   200 ------CVQDSWGAELHKDLKVVD-HGIKV------YKGTNPEVDSYSVFWDNKKLSDTTLNAQL 251
                  .:.:.:...|...::.:| .|:|:      :....|||::                |..
  Rat   148 ILGIPVIITEQYPKGLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEA----------------ALA 196

  Fly   252 KMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIEHTKEK-------VNTS 309
            ::.|...:.:.|:...||:..||::.:..|....::.|......:.|.....|:       |.||
  Rat   197 EIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTTS 261

  Fly   310 DGVIVH-------------TNQVKAMAEGRDRRPELG 333
            :.|::.             .|.:||.|      ||.|
  Rat   262 EAVLLQLVADKDHPKFKEIQNLIKASA------PESG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008 12/63 (19%)
EF-hand_7 21..82 CDD:290234 13/63 (21%)
nicotinamidase 97..315 CDD:238493 41/242 (17%)
Isoc1NP_001014264.2 YcaC_related 115..269 CDD:238494 34/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.