DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and Isoc2b

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_006228336.1 Gene:Isoc2b / 361501 RGDID:1309062 Length:212 Species:Rattus norvegicus


Alignment Length:158 Identity:32/158 - (20%)
Similarity:70/158 - (44%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SWGAELHKDLKVVD-------HGIKVYKGTNPEVDSYSVFWDNKKLSDTT------LNAQL-KMK 254
            |..|.:.|..:::|       |..:....|.||:.:..|    :.:|.|:      |..:| |:.
  Rat    41 SMAARMLKVARILDVPVLLTEHYPQGLGPTVPELGAQGV----RTMSKTSFSMVPPLQQELDKLP 101

  Fly   255 GATDIYVCGLAYDVCVGATAVDALSAGYRT-ILIDDCCRGTDVHDI------EHTKEKVNTSDGV 312
            ....:.:||:...||:..||:|.|..|.:. :.:|.|...::::.:      :|:...::||:.:
  Rat   102 QLKSVLLCGIETQVCILNTALDLLDRGLQVHVAVDACSSQSEMNRLVALARMQHSGVFLSTSEAL 166

  Fly   313 IVHTNQVKAMAEGRDRR-------PELG 333
            .:...:..|..:.::.:       ||:|
  Rat   167 TLQLIKDAAHPQFKEIQKILKEPVPEIG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 28/131 (21%)
Isoc2bXP_006228336.1 YcaC_related 20..172 CDD:238494 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.