DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and pnc1

DIOPT Version :9

Sequence 1:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_596029.2 Gene:pnc1 / 2540906 PomBaseID:SPBC365.20c Length:220 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:71/232 - (30%)
Similarity:112/232 - (48%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 AFLIVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDT-VDFDAVFYSLDWHPSDHVSFIDNV 161
            |.:||||||||:....    .|:.:...|::..||:||:. ..:|.|..:.|.||.||:||..:.
pombe     6 ALIIVDVQNDFVHPVY----ISSGESALEVVPVINRLLENDYKWDTVIATKDVHPKDHLSFTTSH 66

  Fly   162 KMRPMDESSALDSDS-AKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKVVDHGIKVYKG 225
            ...|....:.::.:: ..|:           ||.||..|||:::.|.|....|........:.||
pombe    67 SSTPKPSGTVVNIEAYGHVY-----------KQTLWNSHCVENTPGCEFPDSLNGDRIEFVIPKG 120

  Fly   226 TNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDC 290
            ::..|:|||.|:|... .|..|.|.|..||.||:::.|:|.|:||..||:.| ...|.|.:|.:.
pombe   121 SDRLVESYSGFYDAIG-RDNGLKAILDKKGITDVFIAGVATDICVKETALHA-RHWYNTYIISEA 183

  Fly   291 CRG--TDVH-----DIEHTK-EKVNTSDGVIVHTNQV 319
            .:|  |:.|     |....| |.::..|.::....:|
pombe   184 VKGSSTESHNQAIKDFRDAKIEVISEKDPILQSVRKV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 70/226 (31%)
pnc1NP_596029.2 cysteine_hydrolases 6..207 CDD:294151 69/217 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2067
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5938
Inparanoid 1 1.050 90 1.000 Inparanoid score I1749
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007602
OrthoInspector 1 1.000 - - oto101911
orthoMCL 1 0.900 - - OOG6_100439
Panther 1 1.100 - - LDO PTHR11080
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16483
SonicParanoid 1 1.000 - - X6476
TreeFam 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.