DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naam and marb-1

DIOPT Version :10

Sequence 1:NP_732446.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_502315.1 Gene:marb-1 / 178169 WormBaseID:WBGene00009436 Length:199 Species:Caenorhabditis elegans


Alignment Length:225 Identity:44/225 - (19%)
Similarity:74/225 - (32%) Gaps:46/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LEPINKLLDTVDFDAVFYSLDWHPSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMK 192
            :.|.|..|...|....|.|             |:|..|     .:.:.|.::.|.......|.:.
 Worm    10 INPTNSALFVCDLQEKFAS-------------NIKYFP-----EIITTSRRLIDAARILSIPTIV 56

  Fly   193 QRLWPRHCVQDSWGAELHKDLKVVDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGAT 257
            ...:|                |.:.|.:...|....|   .:..:|..|.|......:..:|...
 Worm    57 TEQYP----------------KGLGHTVPTLKEGLAE---NTPIFDKTKFSMCIPPTEDTLKKVQ 102

  Fly   258 DIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIEHTKEKVNTSDGVIVHTNQ--VK 320
            ::.:.|:...|||..|..|.|..|....::.|...... |...|...|.....|.|:.|::  :.
 Worm   103 NVILVGIEAHVCVLQTTYDLLERGLNVHVVVDAVSSRS-HTDRHFAFKQMEQAGAILTTSEATIL 166

  Fly   321 AMAEGRDRRPELGYKLAMEL---KSPDSVL 347
            .:..|.| .|:  :|...:|   .:||:.|
 Worm   167 GLVGGSD-HPK--FKEVQKLILTSAPDTGL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaamNP_732446.1 FRQ1 <11..82 CDD:444056
nicotinamidase 97..315 CDD:238493 35/186 (19%)
marb-1NP_502315.1 YcaC_related 16..170 CDD:238494 34/191 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.