DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7432 and CG11670

DIOPT Version :9

Sequence 1:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:311 Identity:90/311 - (28%)
Similarity:144/311 - (46%) Gaps:49/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 PQKKPPT-----TTTTTTTEVPLEPEGLDEIGNNIVDPDECGQQEYSTGRIVGGVEAPNGQWPWM 489
            |::.||.     ......||..::.|..    |...:.::.  .:...||   .:.|| ||:|.|
  Fly   130 PRRPPPNHHRNFHNIFLNTESKVDGENY----NKTAETEDL--HDDFNGR---SIVAP-GQYPHM 184

  Fly   490 AAI-FLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSDPV 553
            ||: |.:.....::.||||||..:::||||||.......|     ..|::|||.|........|.
  Fly   185 AALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSP-----DIVKIGDIKLKEWELNVAPQ 244

  Fly   554 TFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPPKERLPGRRATVVGWG 618
            ...|.::..|..::....|:||.::.|::||..:.:|.||      |:.|...:|..:...:|:|
  Fly   245 RRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPV------RLWPMNDIPYGKLHTMGYG 303

  Fly   619 TTYYGGKESTSQRQAELPIWRNEDCDRSYFQPINE--------NFICAGYSDGGVDACQGDSGGP 675
            :|.:...::....:.:|.:...|.|:.|.  |.:|        :.|||...:...|.||||||||
  Fly   304 STGFAQPQTNILTELDLSVVPIEQCNSSL--PADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGP 366

  Fly   676 LMM-------RYDS----HWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWI 715
            |.:       |:.|    .:..:|:.|:|..| ....|||||||:.|:|||
  Fly   367 LQLNLERRRRRHTSRKHYRYYLVGITSYGAYC-RSELPGVYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 80/260 (31%)
Tryp_SPc 475..718 CDD:238113 81/261 (31%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 83/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.