DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7432 and CG1773

DIOPT Version :9

Sequence 1:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:264 Identity:87/264 - (32%)
Similarity:125/264 - (47%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 RIVGGVEAPNGQWPWMAAIFLHGPKRTEFW-CGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVR 537
            ||.||.::.....||||  |||.....|.. |||||:...::||||||.:...:    :::..|.
  Fly    61 RITGGRKSSLLSQPWMA--FLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPR----SKEIRVW 119

  Fly   538 LGDIDLSTDAEPSDPVT-------------FAVKEVRTHERFSRIGFY--NDIAILVLDKPVRKS 587
            ||::|:|:   .||.||             |.:.:...||.|:.  ||  .|||::.|:|.|...
  Fly   120 LGELDISS---TSDCVTYNYQRVCALPVEEFTIDKWILHEEFNL--FYPGYDIALIKLNKKVVFK 179

  Fly   588 KYVIPVCLPKGIRMPPKERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRN-EDCDRSYFQPI 651
            .::.|:|||....:.......|:....||||.|     ||.....:.:.:..| |.|....    
  Fly   180 DHIRPICLPLTDELLAFTLQLGQSYMAVGWGRT-----ESRRFANSTMEVHINTEKCTDGR---- 235

  Fly   652 NENFICAGYSDGGVDACQGDSGGPLMMRY----DSHWVQLGVVSFGNK-CGEPGYPGVYTRVTEY 711
            :.:|:||  :...||.|.|||||||:.:.    .:..||.||||.|:: || .|....|..|..|
  Fly   236 DTSFLCA--NGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTY 297

  Fly   712 LDWI 715
            :.||
  Fly   298 VPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 85/262 (32%)
Tryp_SPc 475..718 CDD:238113 86/263 (33%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 85/262 (32%)
Tryp_SPc 62..301 CDD:238113 84/261 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.