DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7432 and CG30371

DIOPT Version :9

Sequence 1:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:259 Identity:89/259 - (34%)
Similarity:136/259 - (52%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 CGQQEYSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCT-RDSRQKP 528
            ||..  :|.||..|.:|...::|.|||: ....|....:|||:::..:||||||||. :.||   
  Fly   142 CGWS--ATTRIANGQQAAANEFPSMAAL-KDVTKNQASFCGGTIVAHRYILTAAHCIYQVSR--- 200

  Fly   529 FAARQFTVRLGDIDLSTDAEPSDPVTFAVKEVRTHERF-SRIGFYNDIAILVLDKPVRKSKYVIP 592
              |......:|..||...:.......:.::::..||:: |.....||||:|:....::.|:.|.|
  Fly   201 --ATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGP 263

  Fly   593 VCLPK-GIRMPPKERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNEDCDRSY--FQPINEN 654
            :|||. |...|....|    ..|:|:||.::.|..|||.::..|.:..|:||...|  ...|...
  Fly   264 ICLPPVGTSTPFTYDL----VDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTG 324

  Fly   655 FICA-GYSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSFGNKCGEPGYP-GVYTRVTEYLDWIR 716
            .:|. .||..|.|:||.|||||:::|....:: :|::|:|..|.|..|| ||.||:|.|:.|||
  Fly   325 QMCTYDYSGTGRDSCQFDSGGPVILRKSRQFL-VGIISYGKSCAESQYPMGVNTRITSYISWIR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 83/247 (34%)
Tryp_SPc 475..718 CDD:238113 85/249 (34%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 83/247 (34%)
Tryp_SPc 150..389 CDD:238113 85/249 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.