DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7432 and CG3355

DIOPT Version :10

Sequence 1:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:32 Identity:10/32 - (31%)
Similarity:15/32 - (46%) Gaps:8/32 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PQIDYEDMSADLEE--------IPVFIQKRRL 102
            |:|..:.:|.|.::        |...|.||||
  Fly    77 PRISCDYVSLDAQDSTGEQHLHIEHNIYKRRL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 475..718 CDD:238113
CG3355NP_608848.1 Tryp_SPc 76..305 CDD:238113 10/32 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.